Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144351.1 | internal | 152 | 1-456(+) |
Amino Acid sequence : | |||
VTDNPGLPCFLFGHSTGGAIVLKAVLDPKIEARIEGVVLTSPAIRVQPSHPIVEILAPICSLLVPKYQFSSANNKGPPVSRDPEALKAKYSDPLVFTGAIRIRTGYEILRTSYYLQRNLN RVTVPFLVLHGTSDTVTDPEATQRLYQEASST | |||
Physicochemical properties | |||
Number of amino acids: | 152 | ||
Molecular weight: | 16,573.851 | ||
Theoretical pI: | 8.619 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 9065 | ||
Instability index: | 38.136 | ||
aromaticity | 0.072 | ||
GRAVY | -0.016 | ||
Secondary Structure Fraction | |||
Helix | 0.336 | ||
turn | 0.263 | ||
sheet | 0.224 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144351.1 | internal | 152 | 1-456(+) |
Amino Acid sequence : | |||
VTDNPGLPCFLFGHSTGGAIVLKAVLDPKIEARIEGVVLTSPAIRVQPSHPIVEILAPICSLLVPKYQFSSANNKGPPVSRDPEALKAKYSDPLVFTGAIRIRTGYEILRTSYYLQRNLN RVTVPFLVLHGTSDTVTDPEATQRLYQEASST | |||
Physicochemical properties | |||
Number of amino acids: | 152 | ||
Molecular weight: | 16,573.851 | ||
Theoretical pI: | 8.619 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 9065 | ||
Instability index: | 38.136 | ||
aromaticity | 0.072 | ||
GRAVY | -0.016 | ||
Secondary Structure Fraction | |||
Helix | 0.336 | ||
turn | 0.263 | ||
sheet | 0.224 |