| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144353.1 | internal | 196 | 2-589(+) |
Amino Acid sequence : | |||
| KCAIDHILEAEKKGEINEDNVLYIVENINVAAIETTLWSIEWGLAELVNHPDIQQKLRHELDTILGPGVQVTEPDIQKLPYLQAVVKETLRLRMAIPLLVPHMNLNDAKLGGYDIPAESR ILVNAWWLANNPAHWKDPEEFRPERFLEEEAKVEASGNDFRYIPFGVGRRSCPGIILALPILGITIGRLVQNFELS | |||
Physicochemical properties | |||
| Number of amino acids: | 196 | ||
| Molecular weight: | 12,452.378 | ||
| Theoretical pI: | 11.930 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 54.015 | ||
| aromaticity | 0.087 | ||
| GRAVY | 0.026 | ||
Secondary Structure Fraction | |||
| Helix | 0.270 | ||
| turn | 0.357 | ||
| sheet | 0.252 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144353.1 | 5prime_partial | 149 | 589-140(-) |
Amino Acid sequence : | |||
| RELEVLDKPSDCDSEYRQCQYDSRAAPPSNSKGNVSEVIPTRLHLCLLLKEPLRSEFFGVLPVRGVISKPPRVDENPTLRGDVVSAQFRVVEIHVRDEEWDCHAKTESLFDDCLEVGEFL DVGLGDLNARAEDRVELVSEFLLDVGMVH* | |||
Physicochemical properties | |||
| Number of amino acids: | 149 | ||
| Molecular weight: | 12,452.378 | ||
| Theoretical pI: | 11.930 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 54.015 | ||
| aromaticity | 0.087 | ||
| GRAVY | 0.026 | ||
Secondary Structure Fraction | |||
| Helix | 0.270 | ||
| turn | 0.357 | ||
| sheet | 0.252 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144353.1 | 5prime_partial | 115 | 588-241(-) |
Amino Acid sequence : | |||
| ESSKFWTSLPIVIPSIGNASMIPGQLLLPTPKGMYRKSFPLASTFASSSRNLSGRNSSGSFQCAGLLASHHALTRILLSAGMSYPPSFASLRFMCGTRSGIAMRRRRVSLTTAWR* | |||
Physicochemical properties | |||
| Number of amino acids: | 115 | ||
| Molecular weight: | 12,452.378 | ||
| Theoretical pI: | 11.930 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 54.015 | ||
| aromaticity | 0.087 | ||
| GRAVY | 0.026 | ||
Secondary Structure Fraction | |||
| Helix | 0.270 | ||
| turn | 0.357 | ||
| sheet | 0.252 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144353.1 | internal | 196 | 2-589(+) |
Amino Acid sequence : | |||
| KCAIDHILEAEKKGEINEDNVLYIVENINVAAIETTLWSIEWGLAELVNHPDIQQKLRHELDTILGPGVQVTEPDIQKLPYLQAVVKETLRLRMAIPLLVPHMNLNDAKLGGYDIPAESR ILVNAWWLANNPAHWKDPEEFRPERFLEEEAKVEASGNDFRYIPFGVGRRSCPGIILALPILGITIGRLVQNFELS | |||
Physicochemical properties | |||
| Number of amino acids: | 196 | ||
| Molecular weight: | 12,452.378 | ||
| Theoretical pI: | 11.930 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 54.015 | ||
| aromaticity | 0.087 | ||
| GRAVY | 0.026 | ||
Secondary Structure Fraction | |||
| Helix | 0.270 | ||
| turn | 0.357 | ||
| sheet | 0.252 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144353.1 | 5prime_partial | 149 | 589-140(-) |
Amino Acid sequence : | |||
| RELEVLDKPSDCDSEYRQCQYDSRAAPPSNSKGNVSEVIPTRLHLCLLLKEPLRSEFFGVLPVRGVISKPPRVDENPTLRGDVVSAQFRVVEIHVRDEEWDCHAKTESLFDDCLEVGEFL DVGLGDLNARAEDRVELVSEFLLDVGMVH* | |||
Physicochemical properties | |||
| Number of amino acids: | 149 | ||
| Molecular weight: | 12,452.378 | ||
| Theoretical pI: | 11.930 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 54.015 | ||
| aromaticity | 0.087 | ||
| GRAVY | 0.026 | ||
Secondary Structure Fraction | |||
| Helix | 0.270 | ||
| turn | 0.357 | ||
| sheet | 0.252 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144353.1 | 5prime_partial | 115 | 588-241(-) |
Amino Acid sequence : | |||
| ESSKFWTSLPIVIPSIGNASMIPGQLLLPTPKGMYRKSFPLASTFASSSRNLSGRNSSGSFQCAGLLASHHALTRILLSAGMSYPPSFASLRFMCGTRSGIAMRRRRVSLTTAWR* | |||
Physicochemical properties | |||
| Number of amino acids: | 115 | ||
| Molecular weight: | 12,452.378 | ||
| Theoretical pI: | 11.930 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 54.015 | ||
| aromaticity | 0.087 | ||
| GRAVY | 0.026 | ||
Secondary Structure Fraction | |||
| Helix | 0.270 | ||
| turn | 0.357 | ||
| sheet | 0.252 | ||