Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144353.1 | internal | 196 | 2-589(+) |
Amino Acid sequence : | |||
KCAIDHILEAEKKGEINEDNVLYIVENINVAAIETTLWSIEWGLAELVNHPDIQQKLRHELDTILGPGVQVTEPDIQKLPYLQAVVKETLRLRMAIPLLVPHMNLNDAKLGGYDIPAESR ILVNAWWLANNPAHWKDPEEFRPERFLEEEAKVEASGNDFRYIPFGVGRRSCPGIILALPILGITIGRLVQNFELS | |||
Physicochemical properties | |||
Number of amino acids: | 196 | ||
Molecular weight: | 12,452.378 | ||
Theoretical pI: | 11.930 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
Instability index: | 54.015 | ||
aromaticity | 0.087 | ||
GRAVY | 0.026 | ||
Secondary Structure Fraction | |||
Helix | 0.270 | ||
turn | 0.357 | ||
sheet | 0.252 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144353.1 | 5prime_partial | 149 | 589-140(-) |
Amino Acid sequence : | |||
RELEVLDKPSDCDSEYRQCQYDSRAAPPSNSKGNVSEVIPTRLHLCLLLKEPLRSEFFGVLPVRGVISKPPRVDENPTLRGDVVSAQFRVVEIHVRDEEWDCHAKTESLFDDCLEVGEFL DVGLGDLNARAEDRVELVSEFLLDVGMVH* | |||
Physicochemical properties | |||
Number of amino acids: | 149 | ||
Molecular weight: | 12,452.378 | ||
Theoretical pI: | 11.930 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
Instability index: | 54.015 | ||
aromaticity | 0.087 | ||
GRAVY | 0.026 | ||
Secondary Structure Fraction | |||
Helix | 0.270 | ||
turn | 0.357 | ||
sheet | 0.252 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144353.1 | 5prime_partial | 115 | 588-241(-) |
Amino Acid sequence : | |||
ESSKFWTSLPIVIPSIGNASMIPGQLLLPTPKGMYRKSFPLASTFASSSRNLSGRNSSGSFQCAGLLASHHALTRILLSAGMSYPPSFASLRFMCGTRSGIAMRRRRVSLTTAWR* | |||
Physicochemical properties | |||
Number of amino acids: | 115 | ||
Molecular weight: | 12,452.378 | ||
Theoretical pI: | 11.930 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
Instability index: | 54.015 | ||
aromaticity | 0.087 | ||
GRAVY | 0.026 | ||
Secondary Structure Fraction | |||
Helix | 0.270 | ||
turn | 0.357 | ||
sheet | 0.252 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144353.1 | internal | 196 | 2-589(+) |
Amino Acid sequence : | |||
KCAIDHILEAEKKGEINEDNVLYIVENINVAAIETTLWSIEWGLAELVNHPDIQQKLRHELDTILGPGVQVTEPDIQKLPYLQAVVKETLRLRMAIPLLVPHMNLNDAKLGGYDIPAESR ILVNAWWLANNPAHWKDPEEFRPERFLEEEAKVEASGNDFRYIPFGVGRRSCPGIILALPILGITIGRLVQNFELS | |||
Physicochemical properties | |||
Number of amino acids: | 196 | ||
Molecular weight: | 12,452.378 | ||
Theoretical pI: | 11.930 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
Instability index: | 54.015 | ||
aromaticity | 0.087 | ||
GRAVY | 0.026 | ||
Secondary Structure Fraction | |||
Helix | 0.270 | ||
turn | 0.357 | ||
sheet | 0.252 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144353.1 | 5prime_partial | 149 | 589-140(-) |
Amino Acid sequence : | |||
RELEVLDKPSDCDSEYRQCQYDSRAAPPSNSKGNVSEVIPTRLHLCLLLKEPLRSEFFGVLPVRGVISKPPRVDENPTLRGDVVSAQFRVVEIHVRDEEWDCHAKTESLFDDCLEVGEFL DVGLGDLNARAEDRVELVSEFLLDVGMVH* | |||
Physicochemical properties | |||
Number of amino acids: | 149 | ||
Molecular weight: | 12,452.378 | ||
Theoretical pI: | 11.930 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
Instability index: | 54.015 | ||
aromaticity | 0.087 | ||
GRAVY | 0.026 | ||
Secondary Structure Fraction | |||
Helix | 0.270 | ||
turn | 0.357 | ||
sheet | 0.252 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144353.1 | 5prime_partial | 115 | 588-241(-) |
Amino Acid sequence : | |||
ESSKFWTSLPIVIPSIGNASMIPGQLLLPTPKGMYRKSFPLASTFASSSRNLSGRNSSGSFQCAGLLASHHALTRILLSAGMSYPPSFASLRFMCGTRSGIAMRRRRVSLTTAWR* | |||
Physicochemical properties | |||
Number of amino acids: | 115 | ||
Molecular weight: | 12,452.378 | ||
Theoretical pI: | 11.930 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
Instability index: | 54.015 | ||
aromaticity | 0.087 | ||
GRAVY | 0.026 | ||
Secondary Structure Fraction | |||
Helix | 0.270 | ||
turn | 0.357 | ||
sheet | 0.252 |