| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144361.1 | 3prime_partial | 168 | 35-538(+) |
Amino Acid sequence : | |||
| MESIPVIARKLEGKVAVITGGASGIGECTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVDKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVN LIGPFLGTKHAARVMIPARCRGSIISMSSIASVNAGITPHGYACSKHG | |||
Physicochemical properties | |||
| Number of amino acids: | 168 | ||
| Molecular weight: | 17,629.070 | ||
| Theoretical pI: | 6.997 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4720 | ||
| Instability index: | 28.373 | ||
| aromaticity | 0.048 | ||
| GRAVY | 0.155 | ||
Secondary Structure Fraction | |||
| Helix | 0.292 | ||
| turn | 0.262 | ||
| sheet | 0.232 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144361.1 | 3prime_partial | 168 | 35-538(+) |
Amino Acid sequence : | |||
| MESIPVIARKLEGKVAVITGGASGIGECTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVDKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVN LIGPFLGTKHAARVMIPARCRGSIISMSSIASVNAGITPHGYACSKHG | |||
Physicochemical properties | |||
| Number of amino acids: | 168 | ||
| Molecular weight: | 17,629.070 | ||
| Theoretical pI: | 6.997 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4720 | ||
| Instability index: | 28.373 | ||
| aromaticity | 0.048 | ||
| GRAVY | 0.155 | ||
Secondary Structure Fraction | |||
| Helix | 0.292 | ||
| turn | 0.262 | ||
| sheet | 0.232 | ||