| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144362.1 | 5prime_partial | 170 | 3-515(+) |
Amino Acid sequence : | |||
| TRTWNTGVLGPVTLSGLNEGKRDLSQQQWTYQVGMQGEALSLHTLSGSSSVEWGDASHKQPLTWYKALFNAPTGNEPLALDMGSMGKGQAWINGESIGRYWPAYKASGSCSLCDYRGTYD EKKCQLYCGDPSQRWYHVPRSWLKPTGNFLAVFEEWGGDPTGIGMVKRTV* | |||
Physicochemical properties | |||
| Number of amino acids: | 170 | ||
| Molecular weight: | 13,817.832 | ||
| Theoretical pI: | 9.636 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11710 | ||
| Instability index: | 31.293 | ||
| aromaticity | 0.119 | ||
| GRAVY | -0.248 | ||
Secondary Structure Fraction | |||
| Helix | 0.347 | ||
| turn | 0.203 | ||
| sheet | 0.178 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144362.1 | 5prime_partial | 118 | 564-208(-) |
Amino Acid sequence : | |||
| VDVYKVPLTGGLKIGHLILFFSPCRSLLDHRPTLRTQLRNFLWVLTTNVEHGTIFERDRRNIIDTFSHHMFHGSHKDYKTPTLYRQASNDRCFLHLSTLVLFPCYPCLKPTAHFRSGH* | |||
Physicochemical properties | |||
| Number of amino acids: | 118 | ||
| Molecular weight: | 13,817.832 | ||
| Theoretical pI: | 9.636 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11710 | ||
| Instability index: | 31.293 | ||
| aromaticity | 0.119 | ||
| GRAVY | -0.248 | ||
Secondary Structure Fraction | |||
| Helix | 0.347 | ||
| turn | 0.203 | ||
| sheet | 0.178 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144362.1 | 5prime_partial | 170 | 3-515(+) |
Amino Acid sequence : | |||
| TRTWNTGVLGPVTLSGLNEGKRDLSQQQWTYQVGMQGEALSLHTLSGSSSVEWGDASHKQPLTWYKALFNAPTGNEPLALDMGSMGKGQAWINGESIGRYWPAYKASGSCSLCDYRGTYD EKKCQLYCGDPSQRWYHVPRSWLKPTGNFLAVFEEWGGDPTGIGMVKRTV* | |||
Physicochemical properties | |||
| Number of amino acids: | 170 | ||
| Molecular weight: | 13,817.832 | ||
| Theoretical pI: | 9.636 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11710 | ||
| Instability index: | 31.293 | ||
| aromaticity | 0.119 | ||
| GRAVY | -0.248 | ||
Secondary Structure Fraction | |||
| Helix | 0.347 | ||
| turn | 0.203 | ||
| sheet | 0.178 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144362.1 | 5prime_partial | 118 | 564-208(-) |
Amino Acid sequence : | |||
| VDVYKVPLTGGLKIGHLILFFSPCRSLLDHRPTLRTQLRNFLWVLTTNVEHGTIFERDRRNIIDTFSHHMFHGSHKDYKTPTLYRQASNDRCFLHLSTLVLFPCYPCLKPTAHFRSGH* | |||
Physicochemical properties | |||
| Number of amino acids: | 118 | ||
| Molecular weight: | 13,817.832 | ||
| Theoretical pI: | 9.636 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11710 | ||
| Instability index: | 31.293 | ||
| aromaticity | 0.119 | ||
| GRAVY | -0.248 | ||
Secondary Structure Fraction | |||
| Helix | 0.347 | ||
| turn | 0.203 | ||
| sheet | 0.178 | ||