| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144369.1 | internal | 144 | 1-432(+) |
Amino Acid sequence : | |||
| LIPNEKHDQVCYFWPSSSDAQRKFEEMWNMVTGQSGGRIASTTIPVMFGRSLEVPESCNGIARFNFEYLCGRPVGAADYIAIARNYHTVFISDIPVMSMRIRDKARRFITLIDEMYNHHC CLFCLAATSIDNLFQGTEEGTLFD | |||
Physicochemical properties | |||
| Number of amino acids: | 144 | ||
| Molecular weight: | 16,416.569 | ||
| Theoretical pI: | 5.526 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18825 | ||
| Instability index: | 43.476 | ||
| aromaticity | 0.118 | ||
| GRAVY | -0.114 | ||
Secondary Structure Fraction | |||
| Helix | 0.306 | ||
| turn | 0.222 | ||
| sheet | 0.229 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144369.1 | internal | 144 | 1-432(+) |
Amino Acid sequence : | |||
| LIPNEKHDQVCYFWPSSSDAQRKFEEMWNMVTGQSGGRIASTTIPVMFGRSLEVPESCNGIARFNFEYLCGRPVGAADYIAIARNYHTVFISDIPVMSMRIRDKARRFITLIDEMYNHHC CLFCLAATSIDNLFQGTEEGTLFD | |||
Physicochemical properties | |||
| Number of amino acids: | 144 | ||
| Molecular weight: | 16,416.569 | ||
| Theoretical pI: | 5.526 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18825 | ||
| Instability index: | 43.476 | ||
| aromaticity | 0.118 | ||
| GRAVY | -0.114 | ||
Secondary Structure Fraction | |||
| Helix | 0.306 | ||
| turn | 0.222 | ||
| sheet | 0.229 | ||