Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144376.1 | internal | 148 | 2-445(+) |
Amino Acid sequence : | |||
KLVQSKSKKSMLSREYNSEDEDDHTRKLSEVVKDVVDDCQKQVREIHREDEIPLWGQTMFGNQKAPPATFLGQPNCGFIQSLAMDKLNSVLELDAGQGESFLEGLLINGWLLKLSLICGS VEESIASWTFHKLLYSSNEELQVSACDF | |||
Physicochemical properties | |||
Number of amino acids: | 148 | ||
Molecular weight: | 16,681.660 | ||
Theoretical pI: | 4.771 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19730 | ||
Instability index: | 42.749 | ||
aromaticity | 0.074 | ||
GRAVY | -0.389 | ||
Secondary Structure Fraction | |||
Helix | 0.304 | ||
turn | 0.236 | ||
sheet | 0.284 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144376.1 | internal | 148 | 2-445(+) |
Amino Acid sequence : | |||
KLVQSKSKKSMLSREYNSEDEDDHTRKLSEVVKDVVDDCQKQVREIHREDEIPLWGQTMFGNQKAPPATFLGQPNCGFIQSLAMDKLNSVLELDAGQGESFLEGLLINGWLLKLSLICGS VEESIASWTFHKLLYSSNEELQVSACDF | |||
Physicochemical properties | |||
Number of amino acids: | 148 | ||
Molecular weight: | 16,681.660 | ||
Theoretical pI: | 4.771 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19730 | ||
Instability index: | 42.749 | ||
aromaticity | 0.074 | ||
GRAVY | -0.389 | ||
Secondary Structure Fraction | |||
Helix | 0.304 | ||
turn | 0.236 | ||
sheet | 0.284 |