| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144386.1 | internal | 173 | 2-520(+) |
Amino Acid sequence : | |||
| HEQISIQRKREKVSFSSDSLGLFRVMADQRNHPSVYQKVAGQFRIGSTMTQDLHAHNYNIYRPSLYERHSTSSYVNAGIRMPLTQACRGSDLSVVSTVSPVYAQAPVEKNFLVDFLMGGV SAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIGECFSRTIKEEGFGS | |||
Physicochemical properties | |||
| Number of amino acids: | 173 | ||
| Molecular weight: | 19,215.609 | ||
| Theoretical pI: | 9.300 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 10430 10555 | ||
| Instability index: | 40.218 | ||
| aromaticity | 0.081 | ||
| GRAVY | -0.347 | ||
Secondary Structure Fraction | |||
| Helix | 0.283 | ||
| turn | 0.260 | ||
| sheet | 0.225 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144386.1 | internal | 173 | 2-520(+) |
Amino Acid sequence : | |||
| HEQISIQRKREKVSFSSDSLGLFRVMADQRNHPSVYQKVAGQFRIGSTMTQDLHAHNYNIYRPSLYERHSTSSYVNAGIRMPLTQACRGSDLSVVSTVSPVYAQAPVEKNFLVDFLMGGV SAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIGECFSRTIKEEGFGS | |||
Physicochemical properties | |||
| Number of amino acids: | 173 | ||
| Molecular weight: | 19,215.609 | ||
| Theoretical pI: | 9.300 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 10430 10555 | ||
| Instability index: | 40.218 | ||
| aromaticity | 0.081 | ||
| GRAVY | -0.347 | ||
Secondary Structure Fraction | |||
| Helix | 0.283 | ||
| turn | 0.260 | ||
| sheet | 0.225 | ||