Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144389.1 | 5prime_partial | 127 | 3-386(+) |
Amino Acid sequence : | |||
KSRERRRWRREMAFMICFPMMIMMLFLFPLISFAQPISVHTYPAALKSSSVIPQPQDNQQVVGQCLYTVQIHTSCLSPQKTNDYIAIKFGDSFYHRVYKQIKAPRRDFQFRNWLLRHIQH SGPVRYR* | |||
Physicochemical properties | |||
Number of amino acids: | 127 | ||
Molecular weight: | 11,901.477 | ||
Theoretical pI: | 8.965 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
Instability index: | 24.689 | ||
aromaticity | 0.060 | ||
GRAVY | 0.314 | ||
Secondary Structure Fraction | |||
Helix | 0.291 | ||
turn | 0.282 | ||
sheet | 0.231 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144389.1 | 5prime_partial | 117 | 615-262(-) |
Amino Acid sequence : | |||
RAMITVTIIVSHIVVGGRGGDLSSAAVETAPYVIRKNAVKFEHGAAAVATVELPYRYGIGSPAVVPVSAQIQVANAISGTARALNVECVGGASCGTGNPFSAPLFAYTPGDKNCRQT* | |||
Physicochemical properties | |||
Number of amino acids: | 117 | ||
Molecular weight: | 11,901.477 | ||
Theoretical pI: | 8.965 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
Instability index: | 24.689 | ||
aromaticity | 0.060 | ||
GRAVY | 0.314 | ||
Secondary Structure Fraction | |||
Helix | 0.291 | ||
turn | 0.282 | ||
sheet | 0.231 |