| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144391.1 | internal | 179 | 1-537(+) |
Amino Acid sequence : | |||
| EKSPAELALIVEHLMAELEVTAEEDAELNRQSKPAINKLKKLPLLIDVLSKKKLQQEFLDHGVLTLLKNWLEPLPDGSLPNMNIRTAILKILSDFPINLEQYDRKEQLKKSGLGKVIMFL SKSDEETTSNRKLAKELVDKWSRPIFNKSTRFEDMRGYDDERMPYRRPPSKKPMTKAAG | |||
Physicochemical properties | |||
| Number of amino acids: | 179 | ||
| Molecular weight: | 20,599.718 | ||
| Theoretical pI: | 9.139 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 43.209 | ||
| aromaticity | 0.056 | ||
| GRAVY | -0.640 | ||
Secondary Structure Fraction | |||
| Helix | 0.285 | ||
| turn | 0.212 | ||
| sheet | 0.330 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144391.1 | internal | 179 | 1-537(+) |
Amino Acid sequence : | |||
| EKSPAELALIVEHLMAELEVTAEEDAELNRQSKPAINKLKKLPLLIDVLSKKKLQQEFLDHGVLTLLKNWLEPLPDGSLPNMNIRTAILKILSDFPINLEQYDRKEQLKKSGLGKVIMFL SKSDEETTSNRKLAKELVDKWSRPIFNKSTRFEDMRGYDDERMPYRRPPSKKPMTKAAG | |||
Physicochemical properties | |||
| Number of amino acids: | 179 | ||
| Molecular weight: | 20,599.718 | ||
| Theoretical pI: | 9.139 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 43.209 | ||
| aromaticity | 0.056 | ||
| GRAVY | -0.640 | ||
Secondary Structure Fraction | |||
| Helix | 0.285 | ||
| turn | 0.212 | ||
| sheet | 0.330 | ||