| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144395.1 | internal | 124 | 373-2(-) |
Amino Acid sequence : | |||
| QQPLEKHKNLILVAQIPELRPHPLPILVSLHPRAPPVPARPVLVIAFAVPVFAVLAPLVLPLFQEVGVPRLLPLTELVDIPQEVVGLTLDHVAVDLEHAGLEREFEAGEAGLVVLAEEGD RLLQ | |||
Physicochemical properties | |||
| Number of amino acids: | 124 | ||
| Molecular weight: | 14,121.486 | ||
| Theoretical pI: | 4.946 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 40.812 | ||
| aromaticity | 0.065 | ||
| GRAVY | -1.112 | ||
Secondary Structure Fraction | |||
| Helix | 0.226 | ||
| turn | 0.218 | ||
| sheet | 0.250 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144395.1 | internal | 124 | 2-373(+) |
Amino Acid sequence : | |||
| LKQPITLFGEDDEARLSRLKLTLKSGVLEIDSDMIEGQANDFLRDIYEFRKRQKSGNSDFLKKRKHEGGEDGEDRDGEGDDKDGASGDGRSSGMEGDKDGKRMRSEFRDLCDEDKILVFF KRLL | |||
Physicochemical properties | |||
| Number of amino acids: | 124 | ||
| Molecular weight: | 14,121.486 | ||
| Theoretical pI: | 4.946 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 40.812 | ||
| aromaticity | 0.065 | ||
| GRAVY | -1.112 | ||
Secondary Structure Fraction | |||
| Helix | 0.226 | ||
| turn | 0.218 | ||
| sheet | 0.250 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144395.1 | internal | 124 | 373-2(-) |
Amino Acid sequence : | |||
| QQPLEKHKNLILVAQIPELRPHPLPILVSLHPRAPPVPARPVLVIAFAVPVFAVLAPLVLPLFQEVGVPRLLPLTELVDIPQEVVGLTLDHVAVDLEHAGLEREFEAGEAGLVVLAEEGD RLLQ | |||
Physicochemical properties | |||
| Number of amino acids: | 124 | ||
| Molecular weight: | 14,121.486 | ||
| Theoretical pI: | 4.946 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 40.812 | ||
| aromaticity | 0.065 | ||
| GRAVY | -1.112 | ||
Secondary Structure Fraction | |||
| Helix | 0.226 | ||
| turn | 0.218 | ||
| sheet | 0.250 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144395.1 | internal | 124 | 2-373(+) |
Amino Acid sequence : | |||
| LKQPITLFGEDDEARLSRLKLTLKSGVLEIDSDMIEGQANDFLRDIYEFRKRQKSGNSDFLKKRKHEGGEDGEDRDGEGDDKDGASGDGRSSGMEGDKDGKRMRSEFRDLCDEDKILVFF KRLL | |||
Physicochemical properties | |||
| Number of amino acids: | 124 | ||
| Molecular weight: | 14,121.486 | ||
| Theoretical pI: | 4.946 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 40.812 | ||
| aromaticity | 0.065 | ||
| GRAVY | -1.112 | ||
Secondary Structure Fraction | |||
| Helix | 0.226 | ||
| turn | 0.218 | ||
| sheet | 0.250 | ||