| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144401.1 | 5prime_partial | 126 | 2-382(+) |
Amino Acid sequence : | |||
| HEERRRWRREMAFMICFPMMIMMLFLFPLISFAQPISVHTYPAALKSSSVIPQPQDNQQVVGQCLYTVQIHTSCLSPQKTNDYIAIKFGDSFYHRVYKQIKAPRRDFQFRNWLLRHIQHS GPVRYR* | |||
Physicochemical properties | |||
| Number of amino acids: | 126 | ||
| Molecular weight: | 11,901.477 | ||
| Theoretical pI: | 8.965 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
| Instability index: | 24.689 | ||
| aromaticity | 0.060 | ||
| GRAVY | 0.314 | ||
Secondary Structure Fraction | |||
| Helix | 0.291 | ||
| turn | 0.282 | ||
| sheet | 0.231 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144401.1 | 5prime_partial | 117 | 611-258(-) |
Amino Acid sequence : | |||
| RAMITVTIIVSHIVVGGRGGDLSSAAVETAPYVIRKNAVKFEHGAAAVATVELPYRYGIGSPAVVPVSAQIQVANAISGTARALNVECVGGASCGTGNPFSAPLFAYTPGDKNCRQT* | |||
Physicochemical properties | |||
| Number of amino acids: | 117 | ||
| Molecular weight: | 11,901.477 | ||
| Theoretical pI: | 8.965 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
| Instability index: | 24.689 | ||
| aromaticity | 0.060 | ||
| GRAVY | 0.314 | ||
Secondary Structure Fraction | |||
| Helix | 0.291 | ||
| turn | 0.282 | ||
| sheet | 0.231 | ||