| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144406.1 | 5prime_partial | 176 | 2-532(+) |
Amino Acid sequence : | |||
| NSSAMANLRRTLPLLHKTLNLTPSISQPFLHRSRIGAISRFSSDHGSLEFDMSNEENKRQLHNRLLYRSRQRGLLELDLVLGNWVAENIRSMDKHRIKALVDVLDLENPDLWSWLTGQEQ PPEAVNNNPVFAAVRSKVAENLNHAAPETRANPGQPWVRGWDDKRGLESGPKYGNQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 176 | ||
| Molecular weight: | 20,019.280 | ||
| Theoretical pI: | 9.447 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30480 | ||
| Instability index: | 55.618 | ||
| aromaticity | 0.063 | ||
| GRAVY | -0.722 | ||
Secondary Structure Fraction | |||
| Helix | 0.273 | ||
| turn | 0.295 | ||
| sheet | 0.278 | ||