| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144418.1 | 5prime_partial | 174 | 1-525(+) |
Amino Acid sequence : | |||
| EKNSLESRIKIGMDFRVMGLDAPMLSALHHLMEDVSGSPEKEKATAPTRSYVRDATAMAATPLDIKELPNSYVFVVDMPGVKSGEIKVQVEDDGLLVITGERKREDGDKEDQHHKYLRME RRMGKFMRKFSLPENVDTENGISAVCQDGVLTVTVQKKPPPEPKKPKTIEVKVS* | |||
Physicochemical properties | |||
| Number of amino acids: | 174 | ||
| Molecular weight: | 19,464.195 | ||
| Theoretical pI: | 6.521 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
| Instability index: | 36.040 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.601 | ||
Secondary Structure Fraction | |||
| Helix | 0.247 | ||
| turn | 0.218 | ||
| sheet | 0.264 | ||