| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144423.1 | 5prime_partial | 194 | 1-585(+) |
Amino Acid sequence : | |||
| IMSQCGCLATPEDLQGLPALSKFQRTIHSSRDQKFDKAALSIQKKYRGWKGHKAFRTLRQHVVKIQAHVRGHQQRKKYKEFVWAVNVLEKVILRWRRKGVGLRGYRAEPELIDEDEDEDE DIVKVFQKQKVNVAIDQAVSRVFSIVESPTARQQYRRMLEKYRIAKAGLGNAEATLRLEDEIEISQSGDFMNSF* | |||
Physicochemical properties | |||
| Number of amino acids: | 194 | ||
| Molecular weight: | 22,529.562 | ||
| Theoretical pI: | 9.666 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24075 | ||
| Instability index: | 49.764 | ||
| aromaticity | 0.082 | ||
| GRAVY | -0.653 | ||
Secondary Structure Fraction | |||
| Helix | 0.294 | ||
| turn | 0.155 | ||
| sheet | 0.242 | ||