Acc_NO	ORF type	length	start-end position (strand +/-)
>EX144423.1	5prime_partial	194	1-585(+)
Amino Acid sequence :
IMSQCGCLATPEDLQGLPALSKFQRTIHSSRDQKFDKAALSIQKKYRGWKGHKAFRTLRQHVVKIQAHVRGHQQRKKYKEFVWAVNVLEKVILRWRRKGVGLRGYRAEPELIDEDEDEDE DIVKVFQKQKVNVAIDQAVSRVFSIVESPTARQQYRRMLEKYRIAKAGLGNAEATLRLEDEIEISQSGDFMNSF*
Physicochemical properties
Number of amino acids:		194
Molecular weight:		22,529.562
Theoretical pI:		9.666
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		23950 24075
Instability index:		49.764
aromaticity		0.082
GRAVY		-0.653
Secondary Structure Fraction
Helix		0.294
turn		0.155
sheet		0.242