| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144428.1 | 3prime_partial | 170 | 2-511(+) |
Amino Acid sequence : | |||
| MDLDLEVEGGGGSEEVRWENFLPRGSLRVLLVEGDDSTRQIIAALLRKCNYKVDAVSDGKKGWEILKERPQSVDLVLAEVEVPSISGLGLLNMIMDHDVCKNIPVIMMSCHDSVNMVYKC MLKGAADFLVKPVRRNELRNLWQHVWRRNSLIDGRGGAIVHRDGNLAKRR | |||
Physicochemical properties | |||
| Number of amino acids: | 170 | ||
| Molecular weight: | 19,163.033 | ||
| Theoretical pI: | 7.699 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24980 25230 | ||
| Instability index: | 54.661 | ||
| aromaticity | 0.047 | ||
| GRAVY | -0.228 | ||
Secondary Structure Fraction | |||
| Helix | 0.324 | ||
| turn | 0.229 | ||
| sheet | 0.271 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144428.1 | 3prime_partial | 170 | 2-511(+) |
Amino Acid sequence : | |||
| MDLDLEVEGGGGSEEVRWENFLPRGSLRVLLVEGDDSTRQIIAALLRKCNYKVDAVSDGKKGWEILKERPQSVDLVLAEVEVPSISGLGLLNMIMDHDVCKNIPVIMMSCHDSVNMVYKC MLKGAADFLVKPVRRNELRNLWQHVWRRNSLIDGRGGAIVHRDGNLAKRR | |||
Physicochemical properties | |||
| Number of amino acids: | 170 | ||
| Molecular weight: | 19,163.033 | ||
| Theoretical pI: | 7.699 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24980 25230 | ||
| Instability index: | 54.661 | ||
| aromaticity | 0.047 | ||
| GRAVY | -0.228 | ||
Secondary Structure Fraction | |||
| Helix | 0.324 | ||
| turn | 0.229 | ||
| sheet | 0.271 | ||