| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144435.1 | internal | 128 | 2-385(+) |
Amino Acid sequence : | |||
| VPKESQVMAEDFLSDPWRRVFFGRPILRQRYGSSRPPTDWLETPSAHIIRVSVPGLGKDEVKVQLEEGNLLLIQGKEKEEDHVKEAVWHVMDRGKAEFARRIALPDNVKADQIKAHVEKG VLTVVVPK | |||
Physicochemical properties | |||
| Number of amino acids: | 128 | ||
| Molecular weight: | 14,571.597 | ||
| Theoretical pI: | 8.182 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
| Instability index: | 44.952 | ||
| aromaticity | 0.063 | ||
| GRAVY | -0.485 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.195 | ||
| sheet | 0.250 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144435.1 | internal | 128 | 2-385(+) |
Amino Acid sequence : | |||
| VPKESQVMAEDFLSDPWRRVFFGRPILRQRYGSSRPPTDWLETPSAHIIRVSVPGLGKDEVKVQLEEGNLLLIQGKEKEEDHVKEAVWHVMDRGKAEFARRIALPDNVKADQIKAHVEKG VLTVVVPK | |||
Physicochemical properties | |||
| Number of amino acids: | 128 | ||
| Molecular weight: | 14,571.597 | ||
| Theoretical pI: | 8.182 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
| Instability index: | 44.952 | ||
| aromaticity | 0.063 | ||
| GRAVY | -0.485 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.195 | ||
| sheet | 0.250 | ||