| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144444.1 | internal | 150 | 3-452(+) |
Amino Acid sequence : | |||
| FPYYEEHRRLTALHSEIEELLYNPIDNSEHKGFLKDRIKPIIFSMARLDRVKNITGLVELYGRNPRLKELVNLVVVAGDHVKESKDHEEIEEKKKMYRLINEYELEGHIRWISAQMNRVR NGELYRCIADTKGAFVQPALYEAFGLTVIE | |||
Physicochemical properties | |||
| Number of amino acids: | 150 | ||
| Molecular weight: | 17,672.074 | ||
| Theoretical pI: | 6.353 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17420 17420 | ||
| Instability index: | 44.657 | ||
| aromaticity | 0.093 | ||
| GRAVY | -0.497 | ||
Secondary Structure Fraction | |||
| Helix | 0.347 | ||
| turn | 0.173 | ||
| sheet | 0.307 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144444.1 | internal | 150 | 3-452(+) |
Amino Acid sequence : | |||
| FPYYEEHRRLTALHSEIEELLYNPIDNSEHKGFLKDRIKPIIFSMARLDRVKNITGLVELYGRNPRLKELVNLVVVAGDHVKESKDHEEIEEKKKMYRLINEYELEGHIRWISAQMNRVR NGELYRCIADTKGAFVQPALYEAFGLTVIE | |||
Physicochemical properties | |||
| Number of amino acids: | 150 | ||
| Molecular weight: | 17,672.074 | ||
| Theoretical pI: | 6.353 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17420 17420 | ||
| Instability index: | 44.657 | ||
| aromaticity | 0.093 | ||
| GRAVY | -0.497 | ||
Secondary Structure Fraction | |||
| Helix | 0.347 | ||
| turn | 0.173 | ||
| sheet | 0.307 | ||