Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144465.1 | 5prime_partial | 192 | 1-579(+) |
Amino Acid sequence : | |||
VTDNPGLPCFLFGHSTGGAIVLKAVLDPKIEARIEGVVLTSPAIRVQPSHPIVEILAPICSLLVPKYQFSSANNKGPPVSRDPEALKAKYSDPLVFTGAIRIRTGYEILRTSYYLQRNLN RVTVPFLVLHGTSDTVTDPEATQRLYQEASSTDKSIKLYEGFLHDLLFEPERDDIARSIIDWLRSRVDRCSM* | |||
Physicochemical properties | |||
Number of amino acids: | 192 | ||
Molecular weight: | 21,395.303 | ||
Theoretical pI: | 7.059 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16055 | ||
Instability index: | 38.514 | ||
aromaticity | 0.078 | ||
GRAVY | -0.114 | ||
Secondary Structure Fraction | |||
Helix | 0.339 | ||
turn | 0.240 | ||
sheet | 0.229 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144465.1 | 5prime_partial | 192 | 1-579(+) |
Amino Acid sequence : | |||
VTDNPGLPCFLFGHSTGGAIVLKAVLDPKIEARIEGVVLTSPAIRVQPSHPIVEILAPICSLLVPKYQFSSANNKGPPVSRDPEALKAKYSDPLVFTGAIRIRTGYEILRTSYYLQRNLN RVTVPFLVLHGTSDTVTDPEATQRLYQEASSTDKSIKLYEGFLHDLLFEPERDDIARSIIDWLRSRVDRCSM* | |||
Physicochemical properties | |||
Number of amino acids: | 192 | ||
Molecular weight: | 21,395.303 | ||
Theoretical pI: | 7.059 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16055 | ||
Instability index: | 38.514 | ||
aromaticity | 0.078 | ||
GRAVY | -0.114 | ||
Secondary Structure Fraction | |||
Helix | 0.339 | ||
turn | 0.240 | ||
sheet | 0.229 |