Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144483.1 | 3prime_partial | 198 | 33-626(+) |
Amino Acid sequence : | |||
MESIPVIARKLEGKVAVITGGASGIGDCTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVDKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVN LIGPFLGTKHAARVMIPARCRGSIISMSSIASVNAGITPHGYACSKHGVVGLTKCAAFELGTHGIRVNCVSPQLLSTP | |||
Physicochemical properties | |||
Number of amino acids: | 198 | ||
Molecular weight: | 20,708.664 | ||
Theoretical pI: | 7.633 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4845 | ||
Instability index: | 24.606 | ||
aromaticity | 0.045 | ||
GRAVY | 0.221 | ||
Secondary Structure Fraction | |||
Helix | 0.298 | ||
turn | 0.263 | ||
sheet | 0.227 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144483.1 | 3prime_partial | 198 | 33-626(+) |
Amino Acid sequence : | |||
MESIPVIARKLEGKVAVITGGASGIGDCTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVDKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVN LIGPFLGTKHAARVMIPARCRGSIISMSSIASVNAGITPHGYACSKHGVVGLTKCAAFELGTHGIRVNCVSPQLLSTP | |||
Physicochemical properties | |||
Number of amino acids: | 198 | ||
Molecular weight: | 20,708.664 | ||
Theoretical pI: | 7.633 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4845 | ||
Instability index: | 24.606 | ||
aromaticity | 0.045 | ||
GRAVY | 0.221 | ||
Secondary Structure Fraction | |||
Helix | 0.298 | ||
turn | 0.263 | ||
sheet | 0.227 |