| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144483.1 | 3prime_partial | 198 | 33-626(+) |
Amino Acid sequence : | |||
| MESIPVIARKLEGKVAVITGGASGIGDCTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVDKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVN LIGPFLGTKHAARVMIPARCRGSIISMSSIASVNAGITPHGYACSKHGVVGLTKCAAFELGTHGIRVNCVSPQLLSTP | |||
Physicochemical properties | |||
| Number of amino acids: | 198 | ||
| Molecular weight: | 20,708.664 | ||
| Theoretical pI: | 7.633 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4845 | ||
| Instability index: | 24.606 | ||
| aromaticity | 0.045 | ||
| GRAVY | 0.221 | ||
Secondary Structure Fraction | |||
| Helix | 0.298 | ||
| turn | 0.263 | ||
| sheet | 0.227 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144483.1 | 3prime_partial | 198 | 33-626(+) |
Amino Acid sequence : | |||
| MESIPVIARKLEGKVAVITGGASGIGDCTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVDKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVN LIGPFLGTKHAARVMIPARCRGSIISMSSIASVNAGITPHGYACSKHGVVGLTKCAAFELGTHGIRVNCVSPQLLSTP | |||
Physicochemical properties | |||
| Number of amino acids: | 198 | ||
| Molecular weight: | 20,708.664 | ||
| Theoretical pI: | 7.633 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4845 | ||
| Instability index: | 24.606 | ||
| aromaticity | 0.045 | ||
| GRAVY | 0.221 | ||
Secondary Structure Fraction | |||
| Helix | 0.298 | ||
| turn | 0.263 | ||
| sheet | 0.227 | ||