| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144484.1 | internal | 112 | 337-2(-) |
Amino Acid sequence : | |||
| SSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTCASGVSFQSMRVLANAEVSLGKLEFARGTTSRKKLSMGSQRSKDEEGSNTREPNPNGTSDILIVLICSGAEFLQPG | |||
Physicochemical properties | |||
| Number of amino acids: | 112 | ||
| Molecular weight: | 12,586.366 | ||
| Theoretical pI: | 6.400 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 66.456 | ||
| aromaticity | 0.045 | ||
| GRAVY | -0.241 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.207 | ||
| sheet | 0.360 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144484.1 | internal | 111 | 3-335(+) |
Amino Acid sequence : | |||
| PGCRNSAPEQIKTIKMSLVPFGFGSRVFDPSSSFDLWDPIDSFFRDVVPRANSSFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQE | |||
Physicochemical properties | |||
| Number of amino acids: | 111 | ||
| Molecular weight: | 12,586.366 | ||
| Theoretical pI: | 6.400 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 66.456 | ||
| aromaticity | 0.045 | ||
| GRAVY | -0.241 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.207 | ||
| sheet | 0.360 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144484.1 | internal | 111 | 335-3(-) |
Amino Acid sequence : | |||
| LLLLPPLPADLEDPPLLHFHLHLLLLDSGEVGLEHVRLRRLLPVYAGVGERRSLARKARVRTGNHVAEEAIDGIPEIEGRGGIEHSRTESEWNKRHLDCFDLLWCRIPAAR | |||
Physicochemical properties | |||
| Number of amino acids: | 111 | ||
| Molecular weight: | 12,586.366 | ||
| Theoretical pI: | 6.400 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 66.456 | ||
| aromaticity | 0.045 | ||
| GRAVY | -0.241 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.207 | ||
| sheet | 0.360 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144484.1 | internal | 112 | 337-2(-) |
Amino Acid sequence : | |||
| SSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTCASGVSFQSMRVLANAEVSLGKLEFARGTTSRKKLSMGSQRSKDEEGSNTREPNPNGTSDILIVLICSGAEFLQPG | |||
Physicochemical properties | |||
| Number of amino acids: | 112 | ||
| Molecular weight: | 12,586.366 | ||
| Theoretical pI: | 6.400 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 66.456 | ||
| aromaticity | 0.045 | ||
| GRAVY | -0.241 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.207 | ||
| sheet | 0.360 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144484.1 | internal | 111 | 3-335(+) |
Amino Acid sequence : | |||
| PGCRNSAPEQIKTIKMSLVPFGFGSRVFDPSSSFDLWDPIDSFFRDVVPRANSSFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQE | |||
Physicochemical properties | |||
| Number of amino acids: | 111 | ||
| Molecular weight: | 12,586.366 | ||
| Theoretical pI: | 6.400 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 66.456 | ||
| aromaticity | 0.045 | ||
| GRAVY | -0.241 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.207 | ||
| sheet | 0.360 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144484.1 | internal | 111 | 335-3(-) |
Amino Acid sequence : | |||
| LLLLPPLPADLEDPPLLHFHLHLLLLDSGEVGLEHVRLRRLLPVYAGVGERRSLARKARVRTGNHVAEEAIDGIPEIEGRGGIEHSRTESEWNKRHLDCFDLLWCRIPAAR | |||
Physicochemical properties | |||
| Number of amino acids: | 111 | ||
| Molecular weight: | 12,586.366 | ||
| Theoretical pI: | 6.400 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 66.456 | ||
| aromaticity | 0.045 | ||
| GRAVY | -0.241 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.207 | ||
| sheet | 0.360 | ||