| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144485.1 | internal | 109 | 2-328(+) |
Amino Acid sequence : | |||
| SIISMSSIASVNAGITPHGYACSKHGVVGLTKCAAFELGTHGIRVNCVSPQLLSTPLTTGFYNRTEEEVEAVTASVANLKGIIFRAEDVANAVLYLASDESAYVSGQNL | |||
Physicochemical properties | |||
| Number of amino acids: | 109 | ||
| Molecular weight: | 11,375.734 | ||
| Theoretical pI: | 5.453 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
| Instability index: | 30.383 | ||
| aromaticity | 0.064 | ||
| GRAVY | 0.275 | ||
Secondary Structure Fraction | |||
| Helix | 0.312 | ||
| turn | 0.275 | ||
| sheet | 0.275 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144485.1 | internal | 109 | 2-328(+) |
Amino Acid sequence : | |||
| SIISMSSIASVNAGITPHGYACSKHGVVGLTKCAAFELGTHGIRVNCVSPQLLSTPLTTGFYNRTEEEVEAVTASVANLKGIIFRAEDVANAVLYLASDESAYVSGQNL | |||
Physicochemical properties | |||
| Number of amino acids: | 109 | ||
| Molecular weight: | 11,375.734 | ||
| Theoretical pI: | 5.453 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
| Instability index: | 30.383 | ||
| aromaticity | 0.064 | ||
| GRAVY | 0.275 | ||
Secondary Structure Fraction | |||
| Helix | 0.312 | ||
| turn | 0.275 | ||
| sheet | 0.275 | ||