| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144488.1 | internal | 191 | 1-573(+) |
Amino Acid sequence : | |||
| CSNAGRLGSPRRQSGWPVVSTRSSSSASRPSSPRSFGEGEGYNSADEQAPCFVSSYDDAEREQMFEIEIRRTKGLEVKRMMEDGNCLFRAVADQVYGDPEAYDMARQMCIDYMERERDHF SQFITEGFTSYCKRKRRDKVYGNNVEIQAFCEMYNRPIHIYCYSAEPINIFHGSYNTDTPPIRLSYHHGNH | |||
Physicochemical properties | |||
| Number of amino acids: | 191 | ||
| Molecular weight: | 22,034.179 | ||
| Theoretical pI: | 6.098 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23380 23755 | ||
| Instability index: | 64.429 | ||
| aromaticity | 0.115 | ||
| GRAVY | -0.853 | ||
Secondary Structure Fraction | |||
| Helix | 0.230 | ||
| turn | 0.272 | ||
| sheet | 0.199 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144488.1 | internal | 191 | 1-573(+) |
Amino Acid sequence : | |||
| CSNAGRLGSPRRQSGWPVVSTRSSSSASRPSSPRSFGEGEGYNSADEQAPCFVSSYDDAEREQMFEIEIRRTKGLEVKRMMEDGNCLFRAVADQVYGDPEAYDMARQMCIDYMERERDHF SQFITEGFTSYCKRKRRDKVYGNNVEIQAFCEMYNRPIHIYCYSAEPINIFHGSYNTDTPPIRLSYHHGNH | |||
Physicochemical properties | |||
| Number of amino acids: | 191 | ||
| Molecular weight: | 22,034.179 | ||
| Theoretical pI: | 6.098 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23380 23755 | ||
| Instability index: | 64.429 | ||
| aromaticity | 0.115 | ||
| GRAVY | -0.853 | ||
Secondary Structure Fraction | |||
| Helix | 0.230 | ||
| turn | 0.272 | ||
| sheet | 0.199 | ||