Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144488.1 | internal | 191 | 1-573(+) |
Amino Acid sequence : | |||
CSNAGRLGSPRRQSGWPVVSTRSSSSASRPSSPRSFGEGEGYNSADEQAPCFVSSYDDAEREQMFEIEIRRTKGLEVKRMMEDGNCLFRAVADQVYGDPEAYDMARQMCIDYMERERDHF SQFITEGFTSYCKRKRRDKVYGNNVEIQAFCEMYNRPIHIYCYSAEPINIFHGSYNTDTPPIRLSYHHGNH | |||
Physicochemical properties | |||
Number of amino acids: | 191 | ||
Molecular weight: | 22,034.179 | ||
Theoretical pI: | 6.098 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23380 23755 | ||
Instability index: | 64.429 | ||
aromaticity | 0.115 | ||
GRAVY | -0.853 | ||
Secondary Structure Fraction | |||
Helix | 0.230 | ||
turn | 0.272 | ||
sheet | 0.199 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144488.1 | internal | 191 | 1-573(+) |
Amino Acid sequence : | |||
CSNAGRLGSPRRQSGWPVVSTRSSSSASRPSSPRSFGEGEGYNSADEQAPCFVSSYDDAEREQMFEIEIRRTKGLEVKRMMEDGNCLFRAVADQVYGDPEAYDMARQMCIDYMERERDHF SQFITEGFTSYCKRKRRDKVYGNNVEIQAFCEMYNRPIHIYCYSAEPINIFHGSYNTDTPPIRLSYHHGNH | |||
Physicochemical properties | |||
Number of amino acids: | 191 | ||
Molecular weight: | 22,034.179 | ||
Theoretical pI: | 6.098 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23380 23755 | ||
Instability index: | 64.429 | ||
aromaticity | 0.115 | ||
GRAVY | -0.853 | ||
Secondary Structure Fraction | |||
Helix | 0.230 | ||
turn | 0.272 | ||
sheet | 0.199 |