| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144489.1 | internal | 147 | 1-441(+) |
Amino Acid sequence : | |||
| VTDNPGLPCFLFGHSTGGAIVLKAVLDPKIEARIEGVVLTSPAIRVQPSHPIVEILAPICSLLVPKYQFSSANNKGPPVSRDPEALKAKYSDPLVFTGAIRIRTGYEILRTSYYLQRNLN RVTVPFLVLHGTSDTVTDPEATQRLYQ | |||
Physicochemical properties | |||
| Number of amino acids: | 147 | ||
| Molecular weight: | 16,098.401 | ||
| Theoretical pI: | 8.980 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 9065 | ||
| Instability index: | 36.472 | ||
| aromaticity | 0.075 | ||
| GRAVY | 0.011 | ||
Secondary Structure Fraction | |||
| Helix | 0.347 | ||
| turn | 0.259 | ||
| sheet | 0.218 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144489.1 | internal | 147 | 1-441(+) |
Amino Acid sequence : | |||
| VTDNPGLPCFLFGHSTGGAIVLKAVLDPKIEARIEGVVLTSPAIRVQPSHPIVEILAPICSLLVPKYQFSSANNKGPPVSRDPEALKAKYSDPLVFTGAIRIRTGYEILRTSYYLQRNLN RVTVPFLVLHGTSDTVTDPEATQRLYQ | |||
Physicochemical properties | |||
| Number of amino acids: | 147 | ||
| Molecular weight: | 16,098.401 | ||
| Theoretical pI: | 8.980 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 9065 | ||
| Instability index: | 36.472 | ||
| aromaticity | 0.075 | ||
| GRAVY | 0.011 | ||
Secondary Structure Fraction | |||
| Helix | 0.347 | ||
| turn | 0.259 | ||
| sheet | 0.218 | ||