Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144499.1 | 5prime_partial | 180 | 1-543(+) |
Amino Acid sequence : | |||
RNPPAMKKAQDEVRSVIGSKGSIGEADLDQLHYLKCIVKEVMRLHPVIPLIIQRETMQHCIVNGYDIPPKTRLLVNALAIGRDANVWKNPDQFNPDRFIDNPIDFKGHDFELIPFGAGRR RCPGMNFAVLVVELALANLLYTFDWELTAEIAKKGIDMTEAPGLAVHLKYDLHLVAKRYK* | |||
Physicochemical properties | |||
Number of amino acids: | 180 | ||
Molecular weight: | 20,383.547 | ||
Theoretical pI: | 8.437 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18575 | ||
Instability index: | 24.436 | ||
aromaticity | 0.078 | ||
GRAVY | -0.166 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.194 | ||
sheet | 0.267 |