Acc_NO	ORF type	length	start-end position (strand +/-)
>EX144522.1	internal	147	442-2(-)
Amino Acid sequence :
RLRHGNGKNSVLHRSPHLLHLRVLRHPEPPQKLPAAPLHAVPRVVLLLLLLPPLPADLEDPPLLHFHLHLLLLDSGEVGLEHVRLRRLLPVYAGVGERRSLARKARVRTGNHVAEEAIDG IPEIEGRGGIEHSRTESEWNKRHLDCF
Physicochemical properties
Number of amino acids:		147
Molecular weight:		12,585.931
Theoretical pI:		5.436
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		16500 16500
Instability index:		59.387
aromaticity		0.110
GRAVY		-0.707
Secondary Structure Fraction
Helix		0.284
turn		0.239
sheet		0.202

Acc_NO	ORF type	length	start-end position (strand +/-)
>EX144522.1	internal	147	441-1(-)
Amino Acid sequence :
AFGTVTVRTPFSIEALTSSTFAFSGIRNLLRNFPLLLYTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTCASGVSFQSMRVLANAEVSLGKLEFARGTTSRKKLSMG SQRSKDEEGSNTREPNPNGTSDILIVL
Physicochemical properties
Number of amino acids:		147
Molecular weight:		12,585.931
Theoretical pI:		5.436
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		16500 16500
Instability index:		59.387
aromaticity		0.110
GRAVY		-0.707
Secondary Structure Fraction
Helix		0.284
turn		0.239
sheet		0.202

Acc_NO	ORF type	length	start-end position (strand +/-)
>EX144522.1	5prime_partial	109	2-331(+)
Amino Acid sequence :
KTIKMSLVPFGFGSRVFDPSSSFDLWDPIDSFFRDVVPRANSSFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRV*
Physicochemical properties
Number of amino acids:		109
Molecular weight:		12,585.931
Theoretical pI:		5.436
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		16500 16500
Instability index:		59.387
aromaticity		0.110
GRAVY		-0.707
Secondary Structure Fraction
Helix		0.284
turn		0.239
sheet		0.202

Acc_NO	ORF type	length	start-end position (strand +/-)
>EX144522.1	internal	147	442-2(-)
Amino Acid sequence :
RLRHGNGKNSVLHRSPHLLHLRVLRHPEPPQKLPAAPLHAVPRVVLLLLLLPPLPADLEDPPLLHFHLHLLLLDSGEVGLEHVRLRRLLPVYAGVGERRSLARKARVRTGNHVAEEAIDG IPEIEGRGGIEHSRTESEWNKRHLDCF
Physicochemical properties
Number of amino acids:		147
Molecular weight:		12,585.931
Theoretical pI:		5.436
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		16500 16500
Instability index:		59.387
aromaticity		0.110
GRAVY		-0.707
Secondary Structure Fraction
Helix		0.284
turn		0.239
sheet		0.202

Acc_NO	ORF type	length	start-end position (strand +/-)
>EX144522.1	internal	147	441-1(-)
Amino Acid sequence :
AFGTVTVRTPFSIEALTSSTFAFSGIRNLLRNFPLLLYTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTCASGVSFQSMRVLANAEVSLGKLEFARGTTSRKKLSMG SQRSKDEEGSNTREPNPNGTSDILIVL
Physicochemical properties
Number of amino acids:		147
Molecular weight:		12,585.931
Theoretical pI:		5.436
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		16500 16500
Instability index:		59.387
aromaticity		0.110
GRAVY		-0.707
Secondary Structure Fraction
Helix		0.284
turn		0.239
sheet		0.202

Acc_NO	ORF type	length	start-end position (strand +/-)
>EX144522.1	5prime_partial	109	2-331(+)
Amino Acid sequence :
KTIKMSLVPFGFGSRVFDPSSSFDLWDPIDSFFRDVVPRANSSFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRV*
Physicochemical properties
Number of amino acids:		109
Molecular weight:		12,585.931
Theoretical pI:		5.436
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		16500 16500
Instability index:		59.387
aromaticity		0.110
GRAVY		-0.707
Secondary Structure Fraction
Helix		0.284
turn		0.239
sheet		0.202