Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144522.1 | internal | 147 | 442-2(-) |
Amino Acid sequence : | |||
RLRHGNGKNSVLHRSPHLLHLRVLRHPEPPQKLPAAPLHAVPRVVLLLLLLPPLPADLEDPPLLHFHLHLLLLDSGEVGLEHVRLRRLLPVYAGVGERRSLARKARVRTGNHVAEEAIDG IPEIEGRGGIEHSRTESEWNKRHLDCF | |||
Physicochemical properties | |||
Number of amino acids: | 147 | ||
Molecular weight: | 12,585.931 | ||
Theoretical pI: | 5.436 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
Instability index: | 59.387 | ||
aromaticity | 0.110 | ||
GRAVY | -0.707 | ||
Secondary Structure Fraction | |||
Helix | 0.284 | ||
turn | 0.239 | ||
sheet | 0.202 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144522.1 | internal | 147 | 441-1(-) |
Amino Acid sequence : | |||
AFGTVTVRTPFSIEALTSSTFAFSGIRNLLRNFPLLLYTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTCASGVSFQSMRVLANAEVSLGKLEFARGTTSRKKLSMG SQRSKDEEGSNTREPNPNGTSDILIVL | |||
Physicochemical properties | |||
Number of amino acids: | 147 | ||
Molecular weight: | 12,585.931 | ||
Theoretical pI: | 5.436 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
Instability index: | 59.387 | ||
aromaticity | 0.110 | ||
GRAVY | -0.707 | ||
Secondary Structure Fraction | |||
Helix | 0.284 | ||
turn | 0.239 | ||
sheet | 0.202 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144522.1 | 5prime_partial | 109 | 2-331(+) |
Amino Acid sequence : | |||
KTIKMSLVPFGFGSRVFDPSSSFDLWDPIDSFFRDVVPRANSSFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRV* | |||
Physicochemical properties | |||
Number of amino acids: | 109 | ||
Molecular weight: | 12,585.931 | ||
Theoretical pI: | 5.436 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
Instability index: | 59.387 | ||
aromaticity | 0.110 | ||
GRAVY | -0.707 | ||
Secondary Structure Fraction | |||
Helix | 0.284 | ||
turn | 0.239 | ||
sheet | 0.202 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144522.1 | internal | 147 | 442-2(-) |
Amino Acid sequence : | |||
RLRHGNGKNSVLHRSPHLLHLRVLRHPEPPQKLPAAPLHAVPRVVLLLLLLPPLPADLEDPPLLHFHLHLLLLDSGEVGLEHVRLRRLLPVYAGVGERRSLARKARVRTGNHVAEEAIDG IPEIEGRGGIEHSRTESEWNKRHLDCF | |||
Physicochemical properties | |||
Number of amino acids: | 147 | ||
Molecular weight: | 12,585.931 | ||
Theoretical pI: | 5.436 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
Instability index: | 59.387 | ||
aromaticity | 0.110 | ||
GRAVY | -0.707 | ||
Secondary Structure Fraction | |||
Helix | 0.284 | ||
turn | 0.239 | ||
sheet | 0.202 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144522.1 | internal | 147 | 441-1(-) |
Amino Acid sequence : | |||
AFGTVTVRTPFSIEALTSSTFAFSGIRNLLRNFPLLLYTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTCASGVSFQSMRVLANAEVSLGKLEFARGTTSRKKLSMG SQRSKDEEGSNTREPNPNGTSDILIVL | |||
Physicochemical properties | |||
Number of amino acids: | 147 | ||
Molecular weight: | 12,585.931 | ||
Theoretical pI: | 5.436 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
Instability index: | 59.387 | ||
aromaticity | 0.110 | ||
GRAVY | -0.707 | ||
Secondary Structure Fraction | |||
Helix | 0.284 | ||
turn | 0.239 | ||
sheet | 0.202 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144522.1 | 5prime_partial | 109 | 2-331(+) |
Amino Acid sequence : | |||
KTIKMSLVPFGFGSRVFDPSSSFDLWDPIDSFFRDVVPRANSSFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRV* | |||
Physicochemical properties | |||
Number of amino acids: | 109 | ||
Molecular weight: | 12,585.931 | ||
Theoretical pI: | 5.436 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
Instability index: | 59.387 | ||
aromaticity | 0.110 | ||
GRAVY | -0.707 | ||
Secondary Structure Fraction | |||
Helix | 0.284 | ||
turn | 0.239 | ||
sheet | 0.202 |