| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144526.1 | internal | 197 | 2-592(+) |
Amino Acid sequence : | |||
| TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD | |||
Physicochemical properties | |||
| Number of amino acids: | 197 | ||
| Molecular weight: | 13,283.126 | ||
| Theoretical pI: | 4.929 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 17.043 | ||
| aromaticity | 0.040 | ||
| GRAVY | 0.323 | ||
Secondary Structure Fraction | |||
| Helix | 0.381 | ||
| turn | 0.230 | ||
| sheet | 0.341 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144526.1 | 5prime_partial | 126 | 592-212(-) |
Amino Acid sequence : | |||
| VGKGAAVFELLTGKDEPLLVRRNSFLVLNLCLHVVDGVGALDLKGNGLPSQGLDEDLHATTETEHEVEGGLLLDVVVGKGAAVFELLTGKDESLLVRRNSFLVLNLCLHVVDGVGALDLK GNGFAR* | |||
Physicochemical properties | |||
| Number of amino acids: | 126 | ||
| Molecular weight: | 13,283.126 | ||
| Theoretical pI: | 4.929 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 17.043 | ||
| aromaticity | 0.040 | ||
| GRAVY | 0.323 | ||
Secondary Structure Fraction | |||
| Helix | 0.381 | ||
| turn | 0.230 | ||
| sheet | 0.341 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144526.1 | internal | 197 | 2-592(+) |
Amino Acid sequence : | |||
| TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD | |||
Physicochemical properties | |||
| Number of amino acids: | 197 | ||
| Molecular weight: | 13,283.126 | ||
| Theoretical pI: | 4.929 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 17.043 | ||
| aromaticity | 0.040 | ||
| GRAVY | 0.323 | ||
Secondary Structure Fraction | |||
| Helix | 0.381 | ||
| turn | 0.230 | ||
| sheet | 0.341 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144526.1 | 5prime_partial | 126 | 592-212(-) |
Amino Acid sequence : | |||
| VGKGAAVFELLTGKDEPLLVRRNSFLVLNLCLHVVDGVGALDLKGNGLPSQGLDEDLHATTETEHEVEGGLLLDVVVGKGAAVFELLTGKDESLLVRRNSFLVLNLCLHVVDGVGALDLK GNGFAR* | |||
Physicochemical properties | |||
| Number of amino acids: | 126 | ||
| Molecular weight: | 13,283.126 | ||
| Theoretical pI: | 4.929 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 17.043 | ||
| aromaticity | 0.040 | ||
| GRAVY | 0.323 | ||
Secondary Structure Fraction | |||
| Helix | 0.381 | ||
| turn | 0.230 | ||
| sheet | 0.341 | ||