Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144532.1 | internal | 173 | 3-521(+) |
Amino Acid sequence : | |||
RRSGISINSRRRNSCYLRSTMAEEQRCGEGHRLCSNNCGFFGSPATLNLCSKCYRDFRFKEDRADSAKIAVKNSLMRTAVTADAVIVSSDSSASSPDEEEESVLVRAEEAAAVVQSVAAN RCGSCRKKVGLTGFKCRCGATYCGAHRYPETHACGFDYKAAGREAIARDNPLV | |||
Physicochemical properties | |||
Number of amino acids: | 173 | ||
Molecular weight: | 18,121.648 | ||
Theoretical pI: | 11.534 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
Instability index: | 54.931 | ||
aromaticity | 0.036 | ||
GRAVY | -0.277 | ||
Secondary Structure Fraction | |||
Helix | 0.293 | ||
turn | 0.269 | ||
sheet | 0.246 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144532.1 | 5prime_partial | 167 | 521-18(-) |
Amino Acid sequence : | |||
HEWVVTCDRLPPRRLVVEATRVGLRVAVGPAIGGPAPALEPGQPNLLPARPAPVRRHRLDHRRRFLRPNQNALLLLVRRGSGRVGRDDDGVSGDGRPHQRVLDGDLGRVGTVLLEPEISV ALGAEVKGGWAAEKSAVVRAKPVTFSASLLFRHGRSQVTTISSPRIY* | |||
Physicochemical properties | |||
Number of amino acids: | 167 | ||
Molecular weight: | 18,121.648 | ||
Theoretical pI: | 11.534 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
Instability index: | 54.931 | ||
aromaticity | 0.036 | ||
GRAVY | -0.277 | ||
Secondary Structure Fraction | |||
Helix | 0.293 | ||
turn | 0.269 | ||
sheet | 0.246 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144532.1 | internal | 173 | 3-521(+) |
Amino Acid sequence : | |||
RRSGISINSRRRNSCYLRSTMAEEQRCGEGHRLCSNNCGFFGSPATLNLCSKCYRDFRFKEDRADSAKIAVKNSLMRTAVTADAVIVSSDSSASSPDEEEESVLVRAEEAAAVVQSVAAN RCGSCRKKVGLTGFKCRCGATYCGAHRYPETHACGFDYKAAGREAIARDNPLV | |||
Physicochemical properties | |||
Number of amino acids: | 173 | ||
Molecular weight: | 18,121.648 | ||
Theoretical pI: | 11.534 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
Instability index: | 54.931 | ||
aromaticity | 0.036 | ||
GRAVY | -0.277 | ||
Secondary Structure Fraction | |||
Helix | 0.293 | ||
turn | 0.269 | ||
sheet | 0.246 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144532.1 | 5prime_partial | 167 | 521-18(-) |
Amino Acid sequence : | |||
HEWVVTCDRLPPRRLVVEATRVGLRVAVGPAIGGPAPALEPGQPNLLPARPAPVRRHRLDHRRRFLRPNQNALLLLVRRGSGRVGRDDDGVSGDGRPHQRVLDGDLGRVGTVLLEPEISV ALGAEVKGGWAAEKSAVVRAKPVTFSASLLFRHGRSQVTTISSPRIY* | |||
Physicochemical properties | |||
Number of amino acids: | 167 | ||
Molecular weight: | 18,121.648 | ||
Theoretical pI: | 11.534 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
Instability index: | 54.931 | ||
aromaticity | 0.036 | ||
GRAVY | -0.277 | ||
Secondary Structure Fraction | |||
Helix | 0.293 | ||
turn | 0.269 | ||
sheet | 0.246 |