| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144544.1 | internal | 106 | 3-320(+) |
Amino Acid sequence : | |||
| GEGVWNTLAKSAGLKRTGKSCRLRWLNYLRPDVRRGNITPEEQLLIMELHSRWGNRWSKIARQLPGRTDNEIKNYWRTRIQKKTKSEPLDYQNQQMMMVDDASTSH | |||
Physicochemical properties | |||
| Number of amino acids: | 106 | ||
| Molecular weight: | 12,542.168 | ||
| Theoretical pI: | 10.220 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31970 31970 | ||
| Instability index: | 55.587 | ||
| aromaticity | 0.075 | ||
| GRAVY | -1.069 | ||
Secondary Structure Fraction | |||
| Helix | 0.245 | ||
| turn | 0.236 | ||
| sheet | 0.226 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144544.1 | internal | 106 | 3-320(+) |
Amino Acid sequence : | |||
| GEGVWNTLAKSAGLKRTGKSCRLRWLNYLRPDVRRGNITPEEQLLIMELHSRWGNRWSKIARQLPGRTDNEIKNYWRTRIQKKTKSEPLDYQNQQMMMVDDASTSH | |||
Physicochemical properties | |||
| Number of amino acids: | 106 | ||
| Molecular weight: | 12,542.168 | ||
| Theoretical pI: | 10.220 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31970 31970 | ||
| Instability index: | 55.587 | ||
| aromaticity | 0.075 | ||
| GRAVY | -1.069 | ||
Secondary Structure Fraction | |||
| Helix | 0.245 | ||
| turn | 0.236 | ||
| sheet | 0.226 | ||