Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144547.1 | internal | 157 | 472-2(-) |
Amino Acid sequence : | |||
GFLTSAFGTVTVRTPFSIEALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTCASGVSFQSMRVLANAEVSLGKLEFARGTTSRK KLSMGSQRSKDDEGSNTREPNPNGTSDILTALICFLC | |||
Physicochemical properties | |||
Number of amino acids: | 157 | ||
Molecular weight: | 14,545.925 | ||
Theoretical pI: | 9.948 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 62.263 | ||
aromaticity | 0.015 | ||
GRAVY | -0.078 | ||
Secondary Structure Fraction | |||
Helix | 0.362 | ||
turn | 0.231 | ||
sheet | 0.369 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144547.1 | internal | 156 | 3-470(+) |
Amino Acid sequence : | |||
QRKQIRAVKMSLVPFGFGSRVFDPSSSFDLWDPIDSFFRDVVPRANSSFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSSGK FLRRFRMPENAKVEEVRASMENGVLTVTVPKAEVKK | |||
Physicochemical properties | |||
Number of amino acids: | 156 | ||
Molecular weight: | 14,545.925 | ||
Theoretical pI: | 9.948 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 62.263 | ||
aromaticity | 0.015 | ||
GRAVY | -0.078 | ||
Secondary Structure Fraction | |||
Helix | 0.362 | ||
turn | 0.231 | ||
sheet | 0.369 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144547.1 | 5prime_partial | 130 | 470-78(-) |
Amino Acid sequence : | |||
LLDLRLRHGNGKNSVLHRSPHLLHLRVLRHPEPPQKLPAAPLHTVPRVVLLLLLLPPLPADLEDPPLLHFHLHLLLLDSGEVGLEHVRLRRLLPVYAGVGERRSLARKARVRTGNHVAEE AIDGIPEIEG* | |||
Physicochemical properties | |||
Number of amino acids: | 130 | ||
Molecular weight: | 14,545.925 | ||
Theoretical pI: | 9.948 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 62.263 | ||
aromaticity | 0.015 | ||
GRAVY | -0.078 | ||
Secondary Structure Fraction | |||
Helix | 0.362 | ||
turn | 0.231 | ||
sheet | 0.369 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144547.1 | internal | 157 | 472-2(-) |
Amino Acid sequence : | |||
GFLTSAFGTVTVRTPFSIEALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTCASGVSFQSMRVLANAEVSLGKLEFARGTTSRK KLSMGSQRSKDDEGSNTREPNPNGTSDILTALICFLC | |||
Physicochemical properties | |||
Number of amino acids: | 157 | ||
Molecular weight: | 14,545.925 | ||
Theoretical pI: | 9.948 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 62.263 | ||
aromaticity | 0.015 | ||
GRAVY | -0.078 | ||
Secondary Structure Fraction | |||
Helix | 0.362 | ||
turn | 0.231 | ||
sheet | 0.369 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144547.1 | internal | 156 | 3-470(+) |
Amino Acid sequence : | |||
QRKQIRAVKMSLVPFGFGSRVFDPSSSFDLWDPIDSFFRDVVPRANSSFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSSGK FLRRFRMPENAKVEEVRASMENGVLTVTVPKAEVKK | |||
Physicochemical properties | |||
Number of amino acids: | 156 | ||
Molecular weight: | 14,545.925 | ||
Theoretical pI: | 9.948 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 62.263 | ||
aromaticity | 0.015 | ||
GRAVY | -0.078 | ||
Secondary Structure Fraction | |||
Helix | 0.362 | ||
turn | 0.231 | ||
sheet | 0.369 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144547.1 | 5prime_partial | 130 | 470-78(-) |
Amino Acid sequence : | |||
LLDLRLRHGNGKNSVLHRSPHLLHLRVLRHPEPPQKLPAAPLHTVPRVVLLLLLLPPLPADLEDPPLLHFHLHLLLLDSGEVGLEHVRLRRLLPVYAGVGERRSLARKARVRTGNHVAEE AIDGIPEIEG* | |||
Physicochemical properties | |||
Number of amino acids: | 130 | ||
Molecular weight: | 14,545.925 | ||
Theoretical pI: | 9.948 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 62.263 | ||
aromaticity | 0.015 | ||
GRAVY | -0.078 | ||
Secondary Structure Fraction | |||
Helix | 0.362 | ||
turn | 0.231 | ||
sheet | 0.369 |