| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144547.1 | internal | 157 | 472-2(-) |
Amino Acid sequence : | |||
| GFLTSAFGTVTVRTPFSIEALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTCASGVSFQSMRVLANAEVSLGKLEFARGTTSRK KLSMGSQRSKDDEGSNTREPNPNGTSDILTALICFLC | |||
Physicochemical properties | |||
| Number of amino acids: | 157 | ||
| Molecular weight: | 14,545.925 | ||
| Theoretical pI: | 9.948 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 62.263 | ||
| aromaticity | 0.015 | ||
| GRAVY | -0.078 | ||
Secondary Structure Fraction | |||
| Helix | 0.362 | ||
| turn | 0.231 | ||
| sheet | 0.369 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144547.1 | internal | 156 | 3-470(+) |
Amino Acid sequence : | |||
| QRKQIRAVKMSLVPFGFGSRVFDPSSSFDLWDPIDSFFRDVVPRANSSFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSSGK FLRRFRMPENAKVEEVRASMENGVLTVTVPKAEVKK | |||
Physicochemical properties | |||
| Number of amino acids: | 156 | ||
| Molecular weight: | 14,545.925 | ||
| Theoretical pI: | 9.948 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 62.263 | ||
| aromaticity | 0.015 | ||
| GRAVY | -0.078 | ||
Secondary Structure Fraction | |||
| Helix | 0.362 | ||
| turn | 0.231 | ||
| sheet | 0.369 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144547.1 | 5prime_partial | 130 | 470-78(-) |
Amino Acid sequence : | |||
| LLDLRLRHGNGKNSVLHRSPHLLHLRVLRHPEPPQKLPAAPLHTVPRVVLLLLLLPPLPADLEDPPLLHFHLHLLLLDSGEVGLEHVRLRRLLPVYAGVGERRSLARKARVRTGNHVAEE AIDGIPEIEG* | |||
Physicochemical properties | |||
| Number of amino acids: | 130 | ||
| Molecular weight: | 14,545.925 | ||
| Theoretical pI: | 9.948 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 62.263 | ||
| aromaticity | 0.015 | ||
| GRAVY | -0.078 | ||
Secondary Structure Fraction | |||
| Helix | 0.362 | ||
| turn | 0.231 | ||
| sheet | 0.369 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144547.1 | internal | 157 | 472-2(-) |
Amino Acid sequence : | |||
| GFLTSAFGTVTVRTPFSIEALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTCASGVSFQSMRVLANAEVSLGKLEFARGTTSRK KLSMGSQRSKDDEGSNTREPNPNGTSDILTALICFLC | |||
Physicochemical properties | |||
| Number of amino acids: | 157 | ||
| Molecular weight: | 14,545.925 | ||
| Theoretical pI: | 9.948 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 62.263 | ||
| aromaticity | 0.015 | ||
| GRAVY | -0.078 | ||
Secondary Structure Fraction | |||
| Helix | 0.362 | ||
| turn | 0.231 | ||
| sheet | 0.369 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144547.1 | internal | 156 | 3-470(+) |
Amino Acid sequence : | |||
| QRKQIRAVKMSLVPFGFGSRVFDPSSSFDLWDPIDSFFRDVVPRANSSFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSSGK FLRRFRMPENAKVEEVRASMENGVLTVTVPKAEVKK | |||
Physicochemical properties | |||
| Number of amino acids: | 156 | ||
| Molecular weight: | 14,545.925 | ||
| Theoretical pI: | 9.948 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 62.263 | ||
| aromaticity | 0.015 | ||
| GRAVY | -0.078 | ||
Secondary Structure Fraction | |||
| Helix | 0.362 | ||
| turn | 0.231 | ||
| sheet | 0.369 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144547.1 | 5prime_partial | 130 | 470-78(-) |
Amino Acid sequence : | |||
| LLDLRLRHGNGKNSVLHRSPHLLHLRVLRHPEPPQKLPAAPLHTVPRVVLLLLLLPPLPADLEDPPLLHFHLHLLLLDSGEVGLEHVRLRRLLPVYAGVGERRSLARKARVRTGNHVAEE AIDGIPEIEG* | |||
Physicochemical properties | |||
| Number of amino acids: | 130 | ||
| Molecular weight: | 14,545.925 | ||
| Theoretical pI: | 9.948 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 62.263 | ||
| aromaticity | 0.015 | ||
| GRAVY | -0.078 | ||
Secondary Structure Fraction | |||
| Helix | 0.362 | ||
| turn | 0.231 | ||
| sheet | 0.369 | ||