Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144550.1 | 3prime_partial | 113 | 3-341(+) |
Amino Acid sequence : | |||
MGSERKSAVISDESRKLTAYHEGGHALVAIHTDGALPVHKATIVPRGMSLGMVSQLPDKDETSISRKQMLARLDVCMGGRVAEELIFGESEVTSGASSDLKQATSLAKAMVTK | |||
Physicochemical properties | |||
Number of amino acids: | 113 | ||
Molecular weight: | 11,981.624 | ||
Theoretical pI: | 6.906 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 41.240 | ||
aromaticity | 0.018 | ||
GRAVY | -0.171 | ||
Secondary Structure Fraction | |||
Helix | 0.230 | ||
turn | 0.230 | ||
sheet | 0.319 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144550.1 | 3prime_partial | 113 | 3-341(+) |
Amino Acid sequence : | |||
MGSERKSAVISDESRKLTAYHEGGHALVAIHTDGALPVHKATIVPRGMSLGMVSQLPDKDETSISRKQMLARLDVCMGGRVAEELIFGESEVTSGASSDLKQATSLAKAMVTK | |||
Physicochemical properties | |||
Number of amino acids: | 113 | ||
Molecular weight: | 11,981.624 | ||
Theoretical pI: | 6.906 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 41.240 | ||
aromaticity | 0.018 | ||
GRAVY | -0.171 | ||
Secondary Structure Fraction | |||
Helix | 0.230 | ||
turn | 0.230 | ||
sheet | 0.319 |