| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144550.1 | 3prime_partial | 113 | 3-341(+) |
Amino Acid sequence : | |||
| MGSERKSAVISDESRKLTAYHEGGHALVAIHTDGALPVHKATIVPRGMSLGMVSQLPDKDETSISRKQMLARLDVCMGGRVAEELIFGESEVTSGASSDLKQATSLAKAMVTK | |||
Physicochemical properties | |||
| Number of amino acids: | 113 | ||
| Molecular weight: | 11,981.624 | ||
| Theoretical pI: | 6.906 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 41.240 | ||
| aromaticity | 0.018 | ||
| GRAVY | -0.171 | ||
Secondary Structure Fraction | |||
| Helix | 0.230 | ||
| turn | 0.230 | ||
| sheet | 0.319 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144550.1 | 3prime_partial | 113 | 3-341(+) |
Amino Acid sequence : | |||
| MGSERKSAVISDESRKLTAYHEGGHALVAIHTDGALPVHKATIVPRGMSLGMVSQLPDKDETSISRKQMLARLDVCMGGRVAEELIFGESEVTSGASSDLKQATSLAKAMVTK | |||
Physicochemical properties | |||
| Number of amino acids: | 113 | ||
| Molecular weight: | 11,981.624 | ||
| Theoretical pI: | 6.906 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 41.240 | ||
| aromaticity | 0.018 | ||
| GRAVY | -0.171 | ||
Secondary Structure Fraction | |||
| Helix | 0.230 | ||
| turn | 0.230 | ||
| sheet | 0.319 | ||