Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144551.1 | internal | 111 | 2-334(+) |
Amino Acid sequence : | |||
DKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVNLIGPFLGTKHAARVMIPARCRGSIISMSSIASVNAGITPHGYACSKHGVVGLTKCAAFELGTHGIRVNCVSPQ | |||
Physicochemical properties | |||
Number of amino acids: | 111 | ||
Molecular weight: | 11,666.479 | ||
Theoretical pI: | 9.269 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
Instability index: | 24.359 | ||
aromaticity | 0.054 | ||
GRAVY | 0.214 | ||
Secondary Structure Fraction | |||
Helix | 0.297 | ||
turn | 0.288 | ||
sheet | 0.207 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144551.1 | internal | 111 | 2-334(+) |
Amino Acid sequence : | |||
DKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVNLIGPFLGTKHAARVMIPARCRGSIISMSSIASVNAGITPHGYACSKHGVVGLTKCAAFELGTHGIRVNCVSPQ | |||
Physicochemical properties | |||
Number of amino acids: | 111 | ||
Molecular weight: | 11,666.479 | ||
Theoretical pI: | 9.269 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
Instability index: | 24.359 | ||
aromaticity | 0.054 | ||
GRAVY | 0.214 | ||
Secondary Structure Fraction | |||
Helix | 0.297 | ||
turn | 0.288 | ||
sheet | 0.207 |