| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144557.1 | internal | 139 | 2-418(+) |
Amino Acid sequence : | |||
| GFPVEGELDIAVDFMAPSRPGRYVSYWRMASPSGQKFGQRVWVLIQVDYSRPNTPGTVTHPELNLNLPPGSNGRTGVAIIDVNVAPPDSGFTESDITCTAEELVKSVEEHPSQVVVGDLL DASNDALPHPQPTLADVVP | |||
Physicochemical properties | |||
| Number of amino acids: | 139 | ||
| Molecular weight: | 14,918.490 | ||
| Theoretical pI: | 4.437 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 40.743 | ||
| aromaticity | 0.065 | ||
| GRAVY | -0.219 | ||
Secondary Structure Fraction | |||
| Helix | 0.295 | ||
| turn | 0.317 | ||
| sheet | 0.209 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144557.1 | internal | 139 | 2-418(+) |
Amino Acid sequence : | |||
| GFPVEGELDIAVDFMAPSRPGRYVSYWRMASPSGQKFGQRVWVLIQVDYSRPNTPGTVTHPELNLNLPPGSNGRTGVAIIDVNVAPPDSGFTESDITCTAEELVKSVEEHPSQVVVGDLL DASNDALPHPQPTLADVVP | |||
Physicochemical properties | |||
| Number of amino acids: | 139 | ||
| Molecular weight: | 14,918.490 | ||
| Theoretical pI: | 4.437 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 40.743 | ||
| aromaticity | 0.065 | ||
| GRAVY | -0.219 | ||
Secondary Structure Fraction | |||
| Helix | 0.295 | ||
| turn | 0.317 | ||
| sheet | 0.209 | ||