| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144571.1 | 5prime_partial | 130 | 426-34(-) |
Amino Acid sequence : | |||
| SMREPRYPLPRVVHFDSLFKVLFIFPSRYLFAIGLSPLFSLRRNLPPDWGCIPKQPDSSTAPRGAAGSGPDGALTLPGAPFQRTWARSVAEDASPDYNSVGVAARFSSWAVPGSLAVTRG ILVSFFSSAY* | |||
Physicochemical properties | |||
| Number of amino acids: | 130 | ||
| Molecular weight: | 13,305.098 | ||
| Theoretical pI: | 11.392 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 60.574 | ||
| aromaticity | 0.074 | ||
| GRAVY | -0.297 | ||
Secondary Structure Fraction | |||
| Helix | 0.279 | ||
| turn | 0.361 | ||
| sheet | 0.213 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144571.1 | 5prime_partial | 122 | 425-57(-) |
Amino Acid sequence : | |||
| RCESLDIRCRESYTLTLFSKSFSSFPRGTCSLSVSRRYLALDGIYRPIGAAFPNNPTRRQRLVVRQGPGRTGLSPSLAPLSRGLGPGPSLRTLLQTTIRSAWPPDSQAGLFPVRSPLLGE SS* | |||
Physicochemical properties | |||
| Number of amino acids: | 122 | ||
| Molecular weight: | 13,305.098 | ||
| Theoretical pI: | 11.392 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 60.574 | ||
| aromaticity | 0.074 | ||
| GRAVY | -0.297 | ||
Secondary Structure Fraction | |||
| Helix | 0.279 | ||
| turn | 0.361 | ||
| sheet | 0.213 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144571.1 | 5prime_partial | 130 | 426-34(-) |
Amino Acid sequence : | |||
| SMREPRYPLPRVVHFDSLFKVLFIFPSRYLFAIGLSPLFSLRRNLPPDWGCIPKQPDSSTAPRGAAGSGPDGALTLPGAPFQRTWARSVAEDASPDYNSVGVAARFSSWAVPGSLAVTRG ILVSFFSSAY* | |||
Physicochemical properties | |||
| Number of amino acids: | 130 | ||
| Molecular weight: | 13,305.098 | ||
| Theoretical pI: | 11.392 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 60.574 | ||
| aromaticity | 0.074 | ||
| GRAVY | -0.297 | ||
Secondary Structure Fraction | |||
| Helix | 0.279 | ||
| turn | 0.361 | ||
| sheet | 0.213 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144571.1 | 5prime_partial | 122 | 425-57(-) |
Amino Acid sequence : | |||
| RCESLDIRCRESYTLTLFSKSFSSFPRGTCSLSVSRRYLALDGIYRPIGAAFPNNPTRRQRLVVRQGPGRTGLSPSLAPLSRGLGPGPSLRTLLQTTIRSAWPPDSQAGLFPVRSPLLGE SS* | |||
Physicochemical properties | |||
| Number of amino acids: | 122 | ||
| Molecular weight: | 13,305.098 | ||
| Theoretical pI: | 11.392 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 60.574 | ||
| aromaticity | 0.074 | ||
| GRAVY | -0.297 | ||
Secondary Structure Fraction | |||
| Helix | 0.279 | ||
| turn | 0.361 | ||
| sheet | 0.213 | ||