| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144579.1 | internal | 113 | 2-340(+) |
Amino Acid sequence : | |||
| PPGCRNSARGRVEHVDHARKSAEQAVKAIKASEEGKQIEEYDYLPFFYSRAFNLSWQFYGDNVGDTVLFGDDDPTSASPKFGSYWIKDGKVVGAFLESGSGEENSAIAKVAKL | |||
Physicochemical properties | |||
| Number of amino acids: | 113 | ||
| Molecular weight: | 12,409.541 | ||
| Theoretical pI: | 5.356 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18450 | ||
| Instability index: | 34.474 | ||
| aromaticity | 0.124 | ||
| GRAVY | -0.572 | ||
Secondary Structure Fraction | |||
| Helix | 0.274 | ||
| turn | 0.274 | ||
| sheet | 0.230 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144579.1 | internal | 113 | 2-340(+) |
Amino Acid sequence : | |||
| PPGCRNSARGRVEHVDHARKSAEQAVKAIKASEEGKQIEEYDYLPFFYSRAFNLSWQFYGDNVGDTVLFGDDDPTSASPKFGSYWIKDGKVVGAFLESGSGEENSAIAKVAKL | |||
Physicochemical properties | |||
| Number of amino acids: | 113 | ||
| Molecular weight: | 12,409.541 | ||
| Theoretical pI: | 5.356 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18450 | ||
| Instability index: | 34.474 | ||
| aromaticity | 0.124 | ||
| GRAVY | -0.572 | ||
Secondary Structure Fraction | |||
| Helix | 0.274 | ||
| turn | 0.274 | ||
| sheet | 0.230 | ||