| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144589.1 | internal | 142 | 1-426(+) |
Amino Acid sequence : | |||
| ALLVSLFLVLIPSALGGVICEELPQDLCAFAISSSSKRCVLESYHHQHSGTEYQCRTSEVTVQRLFDYVETDECVHSCGVDRNSVGISSDSLLEPQFTAKLCSPRCYQNCPNLIDLYFNL AAGEGVFLPDLCQAQRSNPHRA | |||
Physicochemical properties | |||
| Number of amino acids: | 142 | ||
| Molecular weight: | 15,657.567 | ||
| Theoretical pI: | 5.040 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 8075 | ||
| Instability index: | 41.842 | ||
| aromaticity | 0.077 | ||
| GRAVY | 0.011 | ||
Secondary Structure Fraction | |||
| Helix | 0.317 | ||
| turn | 0.246 | ||
| sheet | 0.254 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144589.1 | internal | 142 | 1-426(+) |
Amino Acid sequence : | |||
| ALLVSLFLVLIPSALGGVICEELPQDLCAFAISSSSKRCVLESYHHQHSGTEYQCRTSEVTVQRLFDYVETDECVHSCGVDRNSVGISSDSLLEPQFTAKLCSPRCYQNCPNLIDLYFNL AAGEGVFLPDLCQAQRSNPHRA | |||
Physicochemical properties | |||
| Number of amino acids: | 142 | ||
| Molecular weight: | 15,657.567 | ||
| Theoretical pI: | 5.040 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 8075 | ||
| Instability index: | 41.842 | ||
| aromaticity | 0.077 | ||
| GRAVY | 0.011 | ||
Secondary Structure Fraction | |||
| Helix | 0.317 | ||
| turn | 0.246 | ||
| sheet | 0.254 | ||