Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144599.1 | internal | 215 | 1-645(+) |
Amino Acid sequence : | |||
ARASQGLKELKDSTIQMASSTGHIDAPVDESVFDIEKEIDDLLPVEVKEQRVSNLLQATMVGGCVAAMPLLKKIPTSVLWGYFAFMAIESLPGNQFWERILLLFTAPSRRYKVLEDYHAT FVETVPFKTITMFTLFQTAYLLICFGITWIPIAGVLFSLMIMLLVPVRQYVMPRLFKGAHLTDLDAAEYEESPALAYDIAAEFDTGVMPARAESA | |||
Physicochemical properties | |||
Number of amino acids: | 215 | ||
Molecular weight: | 23,991.714 | ||
Theoretical pI: | 4.814 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27055 | ||
Instability index: | 47.105 | ||
aromaticity | 0.107 | ||
GRAVY | 0.314 | ||
Secondary Structure Fraction | |||
Helix | 0.363 | ||
turn | 0.167 | ||
sheet | 0.335 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144599.1 | internal | 215 | 1-645(+) |
Amino Acid sequence : | |||
ARASQGLKELKDSTIQMASSTGHIDAPVDESVFDIEKEIDDLLPVEVKEQRVSNLLQATMVGGCVAAMPLLKKIPTSVLWGYFAFMAIESLPGNQFWERILLLFTAPSRRYKVLEDYHAT FVETVPFKTITMFTLFQTAYLLICFGITWIPIAGVLFSLMIMLLVPVRQYVMPRLFKGAHLTDLDAAEYEESPALAYDIAAEFDTGVMPARAESA | |||
Physicochemical properties | |||
Number of amino acids: | 215 | ||
Molecular weight: | 23,991.714 | ||
Theoretical pI: | 4.814 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27055 | ||
Instability index: | 47.105 | ||
aromaticity | 0.107 | ||
GRAVY | 0.314 | ||
Secondary Structure Fraction | |||
Helix | 0.363 | ||
turn | 0.167 | ||
sheet | 0.335 |