| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144601.1 | internal | 145 | 1-435(+) |
Amino Acid sequence : | |||
| TEMRSPNYSLLTQNTIQEILESMGEFVDGLKFSGGSHSLMPKAFIKEITDLAHRHDVYVSTGDWAEHLLRKGPSSFNQYIEECKQLGFDTIELNVGSLKVPEESLLRFIRLAKSYGLRVR PQLEVKFDRADMPVDGDRAFGAYIA | |||
Physicochemical properties | |||
| Number of amino acids: | 145 | ||
| Molecular weight: | 16,426.487 | ||
| Theoretical pI: | 5.558 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
| Instability index: | 47.552 | ||
| aromaticity | 0.097 | ||
| GRAVY | -0.327 | ||
Secondary Structure Fraction | |||
| Helix | 0.317 | ||
| turn | 0.228 | ||
| sheet | 0.276 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144601.1 | internal | 145 | 1-435(+) |
Amino Acid sequence : | |||
| TEMRSPNYSLLTQNTIQEILESMGEFVDGLKFSGGSHSLMPKAFIKEITDLAHRHDVYVSTGDWAEHLLRKGPSSFNQYIEECKQLGFDTIELNVGSLKVPEESLLRFIRLAKSYGLRVR PQLEVKFDRADMPVDGDRAFGAYIA | |||
Physicochemical properties | |||
| Number of amino acids: | 145 | ||
| Molecular weight: | 16,426.487 | ||
| Theoretical pI: | 5.558 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
| Instability index: | 47.552 | ||
| aromaticity | 0.097 | ||
| GRAVY | -0.327 | ||
Secondary Structure Fraction | |||
| Helix | 0.317 | ||
| turn | 0.228 | ||
| sheet | 0.276 | ||