Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144615.1 | internal | 150 | 2-451(+) |
Amino Acid sequence : | |||
NNLDQLRKGMQSAIEIQRAILRQGSSAITRSGFIRSGRKFRWIKLEDPVDTEQLRYPQALTKFCYFLMDALKERGARMKPLICACLAKEPDRVLIVGICGRPQFGALQGNSFGIAFKTAA EEIEAEHFHEFFESSWIVLSTVSVSSFMIR | |||
Physicochemical properties | |||
Number of amino acids: | 150 | ||
Molecular weight: | 17,033.585 | ||
Theoretical pI: | 9.236 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
Instability index: | 47.603 | ||
aromaticity | 0.100 | ||
GRAVY | -0.101 | ||
Secondary Structure Fraction | |||
Helix | 0.313 | ||
turn | 0.200 | ||
sheet | 0.273 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144615.1 | internal | 150 | 2-451(+) |
Amino Acid sequence : | |||
NNLDQLRKGMQSAIEIQRAILRQGSSAITRSGFIRSGRKFRWIKLEDPVDTEQLRYPQALTKFCYFLMDALKERGARMKPLICACLAKEPDRVLIVGICGRPQFGALQGNSFGIAFKTAA EEIEAEHFHEFFESSWIVLSTVSVSSFMIR | |||
Physicochemical properties | |||
Number of amino acids: | 150 | ||
Molecular weight: | 17,033.585 | ||
Theoretical pI: | 9.236 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
Instability index: | 47.603 | ||
aromaticity | 0.100 | ||
GRAVY | -0.101 | ||
Secondary Structure Fraction | |||
Helix | 0.313 | ||
turn | 0.200 | ||
sheet | 0.273 |