Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144632.1 | internal | 187 | 561-1(-) |
Amino Acid sequence : | |||
LSKHTLLSKPSKLSNNNNKARNKAEEKEKETYPLFSIFPHYTRIEITRKRKQSNILDSARTKPGIGLQSQHQAGHRLAGSLGQLALPNGHAVAHPLLGRSTSTCSSDQPRHGEVRVEVLP GLSDYPIRVDRPGVDPEDGACHVTALDEDGGPERVDGEGEEAEGVFWCEAGEQSHHVLVGRWAMEPP | |||
Physicochemical properties | |||
Number of amino acids: | 187 | ||
Molecular weight: | 13,207.023 | ||
Theoretical pI: | 7.140 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 29115 | ||
Instability index: | 21.614 | ||
aromaticity | 0.100 | ||
GRAVY | 0.120 | ||
Secondary Structure Fraction | |||
Helix | 0.325 | ||
turn | 0.233 | ||
sheet | 0.258 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144632.1 | 5prime_partial | 120 | 1-363(+) |
Amino Acid sequence : | |||
WWFHGPPTHQHMMRLLTGLAPEDTFRFLPLSVDAFGPTVLVEGCDVARSVFWVHAWTVNSDGIITQAREYFNTNLTVTRLIGTASTSASAKKRVSHCVPIWESQLAEGAGKSMPGLVLAL * | |||
Physicochemical properties | |||
Number of amino acids: | 120 | ||
Molecular weight: | 13,207.023 | ||
Theoretical pI: | 7.140 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 29115 | ||
Instability index: | 21.614 | ||
aromaticity | 0.100 | ||
GRAVY | 0.120 | ||
Secondary Structure Fraction | |||
Helix | 0.325 | ||
turn | 0.233 | ||
sheet | 0.258 |