Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144640.1 | internal | 248 | 2-745(+) |
Amino Acid sequence : | |||
HERTCAQDERLNISVTPESGMLPMQTMYSSNGWDSYAWAFKAKLSNVCLVIHNPGVEEDPACGPLIDSVAIKTLYPPKHTNTNLLKNGDFEEGPYILPNTSWGVLIPPNIEDDHSPLPGW IIESLKAIKYIDAPHFSIPKGRRAVELVAGKESALAQIVRTIPGKIYTLAFAVGDAANSCEGSMIVEAYAARANVKVPYASKGSGGFKRGVLRFTAISEHTRVVFLSSFYHTKTDGSLCG PVVDDVLL | |||
Physicochemical properties | |||
Number of amino acids: | 248 | ||
Molecular weight: | 14,630.221 | ||
Theoretical pI: | 9.635 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 20970 | ||
Instability index: | 47.057 | ||
aromaticity | 0.111 | ||
GRAVY | -0.729 | ||
Secondary Structure Fraction | |||
Helix | 0.294 | ||
turn | 0.230 | ||
sheet | 0.198 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144640.1 | complete | 126 | 694-314(-) |
Amino Acid sequence : | |||
MVERAKEYHPRVLRYRSEPQHSALKPSRALRCVWNLHIRSRRISFDDHRPFARVGRISDRKGQRVDLAGNRADNLSEGALFAGNEFDGTPSFGDGEVRSVDVFDGLEGFDYPARKWRVIV FDVRWD* | |||
Physicochemical properties | |||
Number of amino acids: | 126 | ||
Molecular weight: | 14,630.221 | ||
Theoretical pI: | 9.635 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 20970 | ||
Instability index: | 47.057 | ||
aromaticity | 0.111 | ||
GRAVY | -0.729 | ||
Secondary Structure Fraction | |||
Helix | 0.294 | ||
turn | 0.230 | ||
sheet | 0.198 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144640.1 | internal | 248 | 2-745(+) |
Amino Acid sequence : | |||
HERTCAQDERLNISVTPESGMLPMQTMYSSNGWDSYAWAFKAKLSNVCLVIHNPGVEEDPACGPLIDSVAIKTLYPPKHTNTNLLKNGDFEEGPYILPNTSWGVLIPPNIEDDHSPLPGW IIESLKAIKYIDAPHFSIPKGRRAVELVAGKESALAQIVRTIPGKIYTLAFAVGDAANSCEGSMIVEAYAARANVKVPYASKGSGGFKRGVLRFTAISEHTRVVFLSSFYHTKTDGSLCG PVVDDVLL | |||
Physicochemical properties | |||
Number of amino acids: | 248 | ||
Molecular weight: | 14,630.221 | ||
Theoretical pI: | 9.635 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 20970 | ||
Instability index: | 47.057 | ||
aromaticity | 0.111 | ||
GRAVY | -0.729 | ||
Secondary Structure Fraction | |||
Helix | 0.294 | ||
turn | 0.230 | ||
sheet | 0.198 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144640.1 | complete | 126 | 694-314(-) |
Amino Acid sequence : | |||
MVERAKEYHPRVLRYRSEPQHSALKPSRALRCVWNLHIRSRRISFDDHRPFARVGRISDRKGQRVDLAGNRADNLSEGALFAGNEFDGTPSFGDGEVRSVDVFDGLEGFDYPARKWRVIV FDVRWD* | |||
Physicochemical properties | |||
Number of amino acids: | 126 | ||
Molecular weight: | 14,630.221 | ||
Theoretical pI: | 9.635 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 20970 | ||
Instability index: | 47.057 | ||
aromaticity | 0.111 | ||
GRAVY | -0.729 | ||
Secondary Structure Fraction | |||
Helix | 0.294 | ||
turn | 0.230 | ||
sheet | 0.198 |