| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144662.1 | 3prime_partial | 192 | 26-601(+) |
Amino Acid sequence : | |||
| MAKVNGSDEPAGRTIEIDQKTLYGVLRGFVEGISADAGGGEPLARRIRSSFFRTAPHLREASRNSVHDLLRWTRQGSPLRALLVISVGTITLISLTGLLVFMIFFVAATLNAIIISALLS LAAAGGFLALFFACLTGIYIAALSTAVFVISAITISTIIAVMVATGWIGFFCIIWLAAKKSMDLTKQSLSIT | |||
Physicochemical properties | |||
| Number of amino acids: | 192 | ||
| Molecular weight: | 20,450.955 | ||
| Theoretical pI: | 9.909 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19605 | ||
| Instability index: | 39.306 | ||
| aromaticity | 0.089 | ||
| GRAVY | 0.824 | ||
Secondary Structure Fraction | |||
| Helix | 0.391 | ||
| turn | 0.208 | ||
| sheet | 0.302 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144662.1 | 3prime_partial | 192 | 26-601(+) |
Amino Acid sequence : | |||
| MAKVNGSDEPAGRTIEIDQKTLYGVLRGFVEGISADAGGGEPLARRIRSSFFRTAPHLREASRNSVHDLLRWTRQGSPLRALLVISVGTITLISLTGLLVFMIFFVAATLNAIIISALLS LAAAGGFLALFFACLTGIYIAALSTAVFVISAITISTIIAVMVATGWIGFFCIIWLAAKKSMDLTKQSLSIT | |||
Physicochemical properties | |||
| Number of amino acids: | 192 | ||
| Molecular weight: | 20,450.955 | ||
| Theoretical pI: | 9.909 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19605 | ||
| Instability index: | 39.306 | ||
| aromaticity | 0.089 | ||
| GRAVY | 0.824 | ||
Secondary Structure Fraction | |||
| Helix | 0.391 | ||
| turn | 0.208 | ||
| sheet | 0.302 | ||