| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144666.1 | internal | 234 | 1-702(+) |
Amino Acid sequence : | |||
| EVAVITGGASGIGECTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVDKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVNLIGPFLGTKHAAR VMIPARCRGSIISMSSIASVNAGITPHGYACSKHGVVGLTKCAAFELGTHGIRVNCVSPQLLSTPLTMGFYNRTEEEVEAVTASVANLKGIIFRAEDVANAVLYLASDESAYVS | |||
Physicochemical properties | |||
| Number of amino acids: | 234 | ||
| Molecular weight: | 24,609.777 | ||
| Theoretical pI: | 5.627 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 9315 | ||
| Instability index: | 28.677 | ||
| aromaticity | 0.060 | ||
| GRAVY | 0.220 | ||
Secondary Structure Fraction | |||
| Helix | 0.308 | ||
| turn | 0.248 | ||
| sheet | 0.261 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144666.1 | internal | 234 | 1-702(+) |
Amino Acid sequence : | |||
| EVAVITGGASGIGECTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVDKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVNLIGPFLGTKHAAR VMIPARCRGSIISMSSIASVNAGITPHGYACSKHGVVGLTKCAAFELGTHGIRVNCVSPQLLSTPLTMGFYNRTEEEVEAVTASVANLKGIIFRAEDVANAVLYLASDESAYVS | |||
Physicochemical properties | |||
| Number of amino acids: | 234 | ||
| Molecular weight: | 24,609.777 | ||
| Theoretical pI: | 5.627 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 9315 | ||
| Instability index: | 28.677 | ||
| aromaticity | 0.060 | ||
| GRAVY | 0.220 | ||
Secondary Structure Fraction | |||
| Helix | 0.308 | ||
| turn | 0.248 | ||
| sheet | 0.261 | ||