Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144668.1 | internal | 140 | 2-421(+) |
Amino Acid sequence : | |||
LTRMRTQFPQLEDPLECMKTIDSLHRLGIDYHFKKEIRDMLGPIYERFCQIEDHLITGDLFEISLSFRLLRQAGHCVSSDVFYKFVDDKQQFDSSLRTDIKGLLNLHEASYLNTGEEILY RANEFTIEHLLTSHMESEDV | |||
Physicochemical properties | |||
Number of amino acids: | 140 | ||
Molecular weight: | 16,502.538 | ||
Theoretical pI: | 5.049 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
Instability index: | 42.732 | ||
aromaticity | 0.100 | ||
GRAVY | -0.378 | ||
Secondary Structure Fraction | |||
Helix | 0.336 | ||
turn | 0.157 | ||
sheet | 0.279 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144668.1 | internal | 140 | 2-421(+) |
Amino Acid sequence : | |||
LTRMRTQFPQLEDPLECMKTIDSLHRLGIDYHFKKEIRDMLGPIYERFCQIEDHLITGDLFEISLSFRLLRQAGHCVSSDVFYKFVDDKQQFDSSLRTDIKGLLNLHEASYLNTGEEILY RANEFTIEHLLTSHMESEDV | |||
Physicochemical properties | |||
Number of amino acids: | 140 | ||
Molecular weight: | 16,502.538 | ||
Theoretical pI: | 5.049 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
Instability index: | 42.732 | ||
aromaticity | 0.100 | ||
GRAVY | -0.378 | ||
Secondary Structure Fraction | |||
Helix | 0.336 | ||
turn | 0.157 | ||
sheet | 0.279 |