| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144668.1 | internal | 140 | 2-421(+) |
Amino Acid sequence : | |||
| LTRMRTQFPQLEDPLECMKTIDSLHRLGIDYHFKKEIRDMLGPIYERFCQIEDHLITGDLFEISLSFRLLRQAGHCVSSDVFYKFVDDKQQFDSSLRTDIKGLLNLHEASYLNTGEEILY RANEFTIEHLLTSHMESEDV | |||
Physicochemical properties | |||
| Number of amino acids: | 140 | ||
| Molecular weight: | 16,502.538 | ||
| Theoretical pI: | 5.049 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
| Instability index: | 42.732 | ||
| aromaticity | 0.100 | ||
| GRAVY | -0.378 | ||
Secondary Structure Fraction | |||
| Helix | 0.336 | ||
| turn | 0.157 | ||
| sheet | 0.279 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144668.1 | internal | 140 | 2-421(+) |
Amino Acid sequence : | |||
| LTRMRTQFPQLEDPLECMKTIDSLHRLGIDYHFKKEIRDMLGPIYERFCQIEDHLITGDLFEISLSFRLLRQAGHCVSSDVFYKFVDDKQQFDSSLRTDIKGLLNLHEASYLNTGEEILY RANEFTIEHLLTSHMESEDV | |||
Physicochemical properties | |||
| Number of amino acids: | 140 | ||
| Molecular weight: | 16,502.538 | ||
| Theoretical pI: | 5.049 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
| Instability index: | 42.732 | ||
| aromaticity | 0.100 | ||
| GRAVY | -0.378 | ||
Secondary Structure Fraction | |||
| Helix | 0.336 | ||
| turn | 0.157 | ||
| sheet | 0.279 | ||