Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144675.1 | 5prime_partial | 159 | 3-482(+) |
Amino Acid sequence : | |||
AFELSERLPHLSLRMKEHSHRALTYSTRMKKMGLKVIYPGLEDHPNHKLLRSMANPGYGFGGMMCVDMGTEERANRLMNHLQNSTEFGLMAVSLGYYETLMSCSGSSTSSELSTQDKELA GISPGLVRMSVGYSGTIDQRWGQFEKAISRMQVDVHAKN* | |||
Physicochemical properties | |||
Number of amino acids: | 159 | ||
Molecular weight: | 14,781.329 | ||
Theoretical pI: | 10.351 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 61.895 | ||
aromaticity | 0.015 | ||
GRAVY | -1.198 | ||
Secondary Structure Fraction | |||
Helix | 0.173 | ||
turn | 0.323 | ||
sheet | 0.188 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144675.1 | 5prime_partial | 133 | 2-403(+) |
Amino Acid sequence : | |||
GVRALGASPPPLPPNERAQPPGADLLDPHEEDGPQGDLPGPRGPPQPQAPQIHGQPRVRIRRHDVRRHGHRGKGEPSHEPPPELHGVWAHGRLSRVLRDPHVVFREQHQQRVEHSGQGAC RHLPRTSQDVCRL* | |||
Physicochemical properties | |||
Number of amino acids: | 133 | ||
Molecular weight: | 14,781.329 | ||
Theoretical pI: | 10.351 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 61.895 | ||
aromaticity | 0.015 | ||
GRAVY | -1.198 | ||
Secondary Structure Fraction | |||
Helix | 0.173 | ||
turn | 0.323 | ||
sheet | 0.188 |