Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144681.1 | 5prime_partial | 185 | 3-560(+) |
Amino Acid sequence : | |||
HGMCADTSRGAAVRDLIARALEGPLDPAQQEQVLVELASDPKLVYHCGITPRKLPELVENNPLIAVEILIKLMNSAEIEEYFTALVNMTMSLRSMEVVNRLTTAVELPTEFVHMYITNCI SSCENIKDKYMQNRLVRLVCVFLQSLIRNKIINVQDLFIEVQAFCIEFSRIREAAGLFRLLKTLE* | |||
Physicochemical properties | |||
Number of amino acids: | 185 | ||
Molecular weight: | 12,991.194 | ||
Theoretical pI: | 10.205 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4720 | ||
Instability index: | 33.883 | ||
aromaticity | 0.124 | ||
GRAVY | 0.358 | ||
Secondary Structure Fraction | |||
Helix | 0.354 | ||
turn | 0.230 | ||
sheet | 0.204 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144681.1 | complete | 113 | 478-137(-) |
Amino Acid sequence : | |||
MNRSCTFIILFRMRLCRKTQTNLTNLFCIYLSLMFSQDDMQFVMYMCTNSVGSSTAVVSLFTTSIERRLMVIFTRAVKYSSISAEFINFMRISTAIRGLFSTNSGNFRGVIPQ* | |||
Physicochemical properties | |||
Number of amino acids: | 113 | ||
Molecular weight: | 12,991.194 | ||
Theoretical pI: | 10.205 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4720 | ||
Instability index: | 33.883 | ||
aromaticity | 0.124 | ||
GRAVY | 0.358 | ||
Secondary Structure Fraction | |||
Helix | 0.354 | ||
turn | 0.230 | ||
sheet | 0.204 |