Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144683.1 | internal | 191 | 2-574(+) |
Amino Acid sequence : | |||
VREVLPRFKMPDDSIPKEAAYQIINDELMLDGNPRLNLASFVTTWMEPECDRLMMDSINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPIGDDETAVGVATVGSSEAIMLAGLAFKRKWQ NKKKAEGKPYDKPNIVTGANVQVCWEKFARYFEVELKEVKLREGYYVMDPVKAVEMVDENTICVAAILGST | |||
Physicochemical properties | |||
Number of amino acids: | 191 | ||
Molecular weight: | 21,620.664 | ||
Theoretical pI: | 4.816 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27180 | ||
Instability index: | 27.731 | ||
aromaticity | 0.084 | ||
GRAVY | -0.254 | ||
Secondary Structure Fraction | |||
Helix | 0.304 | ||
turn | 0.194 | ||
sheet | 0.293 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144683.1 | internal | 191 | 2-574(+) |
Amino Acid sequence : | |||
VREVLPRFKMPDDSIPKEAAYQIINDELMLDGNPRLNLASFVTTWMEPECDRLMMDSINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPIGDDETAVGVATVGSSEAIMLAGLAFKRKWQ NKKKAEGKPYDKPNIVTGANVQVCWEKFARYFEVELKEVKLREGYYVMDPVKAVEMVDENTICVAAILGST | |||
Physicochemical properties | |||
Number of amino acids: | 191 | ||
Molecular weight: | 21,620.664 | ||
Theoretical pI: | 4.816 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27180 | ||
Instability index: | 27.731 | ||
aromaticity | 0.084 | ||
GRAVY | -0.254 | ||
Secondary Structure Fraction | |||
Helix | 0.304 | ||
turn | 0.194 | ||
sheet | 0.293 |