| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144683.1 | internal | 191 | 2-574(+) |
Amino Acid sequence : | |||
| VREVLPRFKMPDDSIPKEAAYQIINDELMLDGNPRLNLASFVTTWMEPECDRLMMDSINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPIGDDETAVGVATVGSSEAIMLAGLAFKRKWQ NKKKAEGKPYDKPNIVTGANVQVCWEKFARYFEVELKEVKLREGYYVMDPVKAVEMVDENTICVAAILGST | |||
Physicochemical properties | |||
| Number of amino acids: | 191 | ||
| Molecular weight: | 21,620.664 | ||
| Theoretical pI: | 4.816 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27180 | ||
| Instability index: | 27.731 | ||
| aromaticity | 0.084 | ||
| GRAVY | -0.254 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.194 | ||
| sheet | 0.293 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144683.1 | internal | 191 | 2-574(+) |
Amino Acid sequence : | |||
| VREVLPRFKMPDDSIPKEAAYQIINDELMLDGNPRLNLASFVTTWMEPECDRLMMDSINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPIGDDETAVGVATVGSSEAIMLAGLAFKRKWQ NKKKAEGKPYDKPNIVTGANVQVCWEKFARYFEVELKEVKLREGYYVMDPVKAVEMVDENTICVAAILGST | |||
Physicochemical properties | |||
| Number of amino acids: | 191 | ||
| Molecular weight: | 21,620.664 | ||
| Theoretical pI: | 4.816 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27180 | ||
| Instability index: | 27.731 | ||
| aromaticity | 0.084 | ||
| GRAVY | -0.254 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.194 | ||
| sheet | 0.293 | ||