| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144688.1 | internal | 175 | 1-525(+) |
Amino Acid sequence : | |||
| FGTQLVWVGGDQFGDHSSADLEIPENGFPVEGELDIAVDFMAPSRPGRYVSYWRMASPSGQKFGQRVWVLIQVDYSRPNTPGTVTHPELNLNLPPGSNGRTGVAIIDVNVAPPDSGFTES DITCTAEELVKSVEEHPSQVVVGDLLDASNDALPHPQPTLADVVPPTTLYPLIDI | |||
Physicochemical properties | |||
| Number of amino acids: | 175 | ||
| Molecular weight: | 18,846.759 | ||
| Theoretical pI: | 4.224 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22460 | ||
| Instability index: | 36.298 | ||
| aromaticity | 0.074 | ||
| GRAVY | -0.188 | ||
Secondary Structure Fraction | |||
| Helix | 0.309 | ||
| turn | 0.309 | ||
| sheet | 0.206 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144688.1 | internal | 175 | 1-525(+) |
Amino Acid sequence : | |||
| FGTQLVWVGGDQFGDHSSADLEIPENGFPVEGELDIAVDFMAPSRPGRYVSYWRMASPSGQKFGQRVWVLIQVDYSRPNTPGTVTHPELNLNLPPGSNGRTGVAIIDVNVAPPDSGFTES DITCTAEELVKSVEEHPSQVVVGDLLDASNDALPHPQPTLADVVPPTTLYPLIDI | |||
Physicochemical properties | |||
| Number of amino acids: | 175 | ||
| Molecular weight: | 18,846.759 | ||
| Theoretical pI: | 4.224 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22460 | ||
| Instability index: | 36.298 | ||
| aromaticity | 0.074 | ||
| GRAVY | -0.188 | ||
Secondary Structure Fraction | |||
| Helix | 0.309 | ||
| turn | 0.309 | ||
| sheet | 0.206 | ||