| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144727.1 | complete | 230 | 60-752(+) |
Amino Acid sequence : | |||
| MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGDM* | |||
Physicochemical properties | |||
| Number of amino acids: | 230 | ||
| Molecular weight: | 24,807.748 | ||
| Theoretical pI: | 8.666 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 52.378 | ||
| aromaticity | 0.032 | ||
| GRAVY | -0.024 | ||
Secondary Structure Fraction | |||
| Helix | 0.376 | ||
| turn | 0.240 | ||
| sheet | 0.312 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144727.1 | 5prime_partial | 221 | 767-102(-) |
Amino Acid sequence : | |||
| HRSQISHITTTETENKMEGGLLLDVVIRKGPPILQLLPSKNQPLLVRRNPLLILNLRLHIINRIRALHLQSNSLPGQGLHEYLHATTKPQNEMEGRLLLDVVVRKGPPILQLFPGKDEPL LVRRNPFLVLNLCLHIVNRVGALNLEGNGLPSQGLDEYLHATTETEHEVERRLLLNVVVGKGAAVFELLTGKDEPLLVRRNPFLVLDLSLDIVDCVRGFNL* | |||
Physicochemical properties | |||
| Number of amino acids: | 221 | ||
| Molecular weight: | 24,807.748 | ||
| Theoretical pI: | 8.666 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 52.378 | ||
| aromaticity | 0.032 | ||
| GRAVY | -0.024 | ||
Secondary Structure Fraction | |||
| Helix | 0.376 | ||
| turn | 0.240 | ||
| sheet | 0.312 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144727.1 | complete | 230 | 60-752(+) |
Amino Acid sequence : | |||
| MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGDM* | |||
Physicochemical properties | |||
| Number of amino acids: | 230 | ||
| Molecular weight: | 24,807.748 | ||
| Theoretical pI: | 8.666 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 52.378 | ||
| aromaticity | 0.032 | ||
| GRAVY | -0.024 | ||
Secondary Structure Fraction | |||
| Helix | 0.376 | ||
| turn | 0.240 | ||
| sheet | 0.312 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX144727.1 | 5prime_partial | 221 | 767-102(-) |
Amino Acid sequence : | |||
| HRSQISHITTTETENKMEGGLLLDVVIRKGPPILQLLPSKNQPLLVRRNPLLILNLRLHIINRIRALHLQSNSLPGQGLHEYLHATTKPQNEMEGRLLLDVVVRKGPPILQLFPGKDEPL LVRRNPFLVLNLCLHIVNRVGALNLEGNGLPSQGLDEYLHATTETEHEVERRLLLNVVVGKGAAVFELLTGKDEPLLVRRNPFLVLDLSLDIVDCVRGFNL* | |||
Physicochemical properties | |||
| Number of amino acids: | 221 | ||
| Molecular weight: | 24,807.748 | ||
| Theoretical pI: | 8.666 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 52.378 | ||
| aromaticity | 0.032 | ||
| GRAVY | -0.024 | ||
Secondary Structure Fraction | |||
| Helix | 0.376 | ||
| turn | 0.240 | ||
| sheet | 0.312 | ||