Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144736.1 | 3prime_partial | 120 | 3-362(+) |
Amino Acid sequence : | |||
MEEDLILINYIANHGEGVWNTLAKSAGLKRTGKSCRLRWLNYLRPDVRRGNITPEEQLLIMELHSRWGNRWSKIARQLPGRTDNEIKNYWRTRIQKKTKSEPLDYQNQQMMMVDDASTSH | |||
Physicochemical properties | |||
Number of amino acids: | 120 | ||
Molecular weight: | 14,212.063 | ||
Theoretical pI: | 9.715 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33460 | ||
Instability index: | 55.331 | ||
aromaticity | 0.075 | ||
GRAVY | -0.921 | ||
Secondary Structure Fraction | |||
Helix | 0.267 | ||
turn | 0.225 | ||
sheet | 0.250 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144736.1 | 3prime_partial | 120 | 3-362(+) |
Amino Acid sequence : | |||
MEEDLILINYIANHGEGVWNTLAKSAGLKRTGKSCRLRWLNYLRPDVRRGNITPEEQLLIMELHSRWGNRWSKIARQLPGRTDNEIKNYWRTRIQKKTKSEPLDYQNQQMMMVDDASTSH | |||
Physicochemical properties | |||
Number of amino acids: | 120 | ||
Molecular weight: | 14,212.063 | ||
Theoretical pI: | 9.715 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33460 | ||
Instability index: | 55.331 | ||
aromaticity | 0.075 | ||
GRAVY | -0.921 | ||
Secondary Structure Fraction | |||
Helix | 0.267 | ||
turn | 0.225 | ||
sheet | 0.250 |