Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144739.1 | internal | 209 | 3-629(+) |
Amino Acid sequence : | |||
AMDNAGLKCAIDHILEAEKKGEINEDNVLYIVENINVAAIETTLWSIEWGLAELVNHPDIQQKLRHELDTILGPGVQVTEPDIQKLPYLQAVVKETLRLRMAIPLLVPHMNLNDAKLGGY DIPAESRILVNAWWLANNPAHWKDPEEFRPERFLEEEAKVEASGNDFRYIPFGVGRRSCPGIILALPILGITIGRLVQNFELSPPPGQS | |||
Physicochemical properties | |||
Number of amino acids: | 209 | ||
Molecular weight: | 17,659.766 | ||
Theoretical pI: | 4.960 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
Instability index: | 49.538 | ||
aromaticity | 0.058 | ||
GRAVY | -0.408 | ||
Secondary Structure Fraction | |||
Helix | 0.316 | ||
turn | 0.206 | ||
sheet | 0.271 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144739.1 | 5prime_partial | 155 | 629-162(-) |
Amino Acid sequence : | |||
RLTRRRRELEVLDKPSDCDSEYRQCQYDSRAAPPSNSKGNVSEVIPTRLHLCLLLKEPLRSEFFGVLPVRGVISKPPRVDENPTLRGDVVSAQFRVVEIHVRDEEWDCHAKTESLFDDCL EVGEFLDVGLGDLNARAEDRVELVSEFLLDVGMVH* | |||
Physicochemical properties | |||
Number of amino acids: | 155 | ||
Molecular weight: | 17,659.766 | ||
Theoretical pI: | 4.960 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
Instability index: | 49.538 | ||
aromaticity | 0.058 | ||
GRAVY | -0.408 | ||
Secondary Structure Fraction | |||
Helix | 0.316 | ||
turn | 0.206 | ||
sheet | 0.271 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144739.1 | internal | 209 | 3-629(+) |
Amino Acid sequence : | |||
AMDNAGLKCAIDHILEAEKKGEINEDNVLYIVENINVAAIETTLWSIEWGLAELVNHPDIQQKLRHELDTILGPGVQVTEPDIQKLPYLQAVVKETLRLRMAIPLLVPHMNLNDAKLGGY DIPAESRILVNAWWLANNPAHWKDPEEFRPERFLEEEAKVEASGNDFRYIPFGVGRRSCPGIILALPILGITIGRLVQNFELSPPPGQS | |||
Physicochemical properties | |||
Number of amino acids: | 209 | ||
Molecular weight: | 17,659.766 | ||
Theoretical pI: | 4.960 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
Instability index: | 49.538 | ||
aromaticity | 0.058 | ||
GRAVY | -0.408 | ||
Secondary Structure Fraction | |||
Helix | 0.316 | ||
turn | 0.206 | ||
sheet | 0.271 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX144739.1 | 5prime_partial | 155 | 629-162(-) |
Amino Acid sequence : | |||
RLTRRRRELEVLDKPSDCDSEYRQCQYDSRAAPPSNSKGNVSEVIPTRLHLCLLLKEPLRSEFFGVLPVRGVISKPPRVDENPTLRGDVVSAQFRVVEIHVRDEEWDCHAKTESLFDDCL EVGEFLDVGLGDLNARAEDRVELVSEFLLDVGMVH* | |||
Physicochemical properties | |||
Number of amino acids: | 155 | ||
Molecular weight: | 17,659.766 | ||
Theoretical pI: | 4.960 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
Instability index: | 49.538 | ||
aromaticity | 0.058 | ||
GRAVY | -0.408 | ||
Secondary Structure Fraction | |||
Helix | 0.316 | ||
turn | 0.206 | ||
sheet | 0.271 |